KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM244170Help
Entry
Phum_PHUM244170   CDS       T01223                                 

Definition
Ubl carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Phum_PHUM244170
Peptidases [BR:phu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Phum_PHUM244170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 511 aa AA seqDB search
MECPHLIENVKIDIILGDKTQELGKDKECAVCSNEINPWLCLYCGLIHCGRYVNGHAREH
SIKAKQHCVCMDVENYSVFCYVCDEYVNNDAENKDISRIRQILRDRKQREPDSESLENDE
VGEFNNSSTPNSLIDDDQASWKSGNSDLLGRETQENSRSLRPRFRKRSHSNDSCNENTTK
IHCTRPRPSREKKTPLVGLRNLGNTCFMNAVLQSLSNIQEFCLYFKQLPSLERNTNGRKV
YHSTRSIKEISEELIAEELRKVLISLNQGDGKEAISPNELFSAIWKVVPRFRGYQQQDAH
EFLRYMLDRLHTELLSLLPDETLRDNIPDKYLYSQKKTKDLDETLPPCTIADCLTSFIEV
EELAETELYYCNNCKSKQRSTKRFWIRRLPNVLCLHLKRFRWNSHFRTKIDTEIVFPTTA
LDMSQFVLSNIHETRQSGAGTNLYDLAAVIVHHGSGVGCGHYTAFAINDGEWFHFNDSTV
RPTGQATVAKCKPYILFYIRREFTLPRVQNS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtccacatttaatagaaaatgttaaaattgatatcattttaggagacaaaacg
caagaattaggaaaggataaagagtgcgcagtatgttctaatgaaattaacccctggctg
tgtctgtattgtggtctcattcattgtggaagatatgtgaatggccacgctcgagaacac
tcgattaaagcgaaacagcattgtgtgtgcatggatgtagaaaattattcggttttttgt
tacgtatgcgatgaatatgtaaataacgacgctgaaaataaagatatcagtagaattcgt
caaattttaagagatcgaaaacaaagggaacccgattcagagtctttggaaaatgatgaa
gttggagaatttaataattcttcgactccaaattcattaatagatgacgaccaagcatct
tggaagtcaggaaattcagatttattaggaagagaaacacaagaaaattcaaggtcactt
aggccacgttttagaaaacgatctcattccaatgatagctgtaatgaaaacacaactaaa
atccattgcactagacctcgaccatctagagaaaagaaaactccgttggtgggtctacga
aatttgggaaatacatgttttatgaatgccgttttgcagtctctgagtaatattcaagag
ttttgcctctacttcaaacagcttccatcacttgagcgtaacacaaatggtcgaaaggta
tatcattcaacgaggagtattaaagaaataagcgaagaattaattgctgaagaacttcga
aaagttttgataagtttgaatcagggtgatggtaaagaagccatatcaccgaatgaatta
ttttccgctatatggaaagtggtgcctcgttttagaggttaccagcaacaagatgctcat
gaatttttgcgatacatgcttgatagactccacaccgaactacttagcttactacccgat
gaaacattacgggataatataccagataaatatttatatagtcaaaagaaaactaaagac
ttagatgaaacattaccgccgtgcacaattgctgattgtttgacaagtttcatagaagtg
gaagaattggccgaaactgaattgtattattgcaacaattgtaagagtaaacaaagatcg
acaaaaagattttggatcagaagattgccgaacgtgttgtgtcttcacttgaaaagattt
cgctggaattcacatttccgaacaaaaatcgacaccgaaatagtttttccaacgacggct
ctcgacatgtcacaattcgtactaagtaatatacacgaaactagacaaagcggagctgga
acaaatttatacgatttggcagctgttatcgtccatcacggatctggggtaggatgcggt
cattatacagcattcgcaattaacgatggagaatggtttcattttaacgacagcacggtt
cgtccaacaggacaagcaacagttgccaagtgtaaaccttacatattattttacataaga
agagaattcacgttgccccgcgttcaaaattcatga

DBGET integrated database retrieval system