KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM246240Help
Entry
Phum_PHUM246240   CDS       T01223                                 

Definition
Furin-1 precursor, putative (EC:3.4.21.93)
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     Phum_PHUM246240
Peptidases [BR:phu01002]
 Serine Peptidases
  Family S8: subtilisin family
   Phum_PHUM246240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 678 aa AA seqDB search
MVKFFWSFITIFLILKFTISAHNGEEHTKYYSNEWVIRLEGGQDVAELISAKLGYKLLGK
VTGFNDTYRIIKEDIFIQKKRNHALLTETLEKDSRVIWAEQQFTKERVKRGFLYDNSLST
VYNENNEKLTRQSILNLLKEKNISYNQEKILFRPSDVSMRYASYDRFNDELWNQQWYLQD
TRTQSNLPKLDLHVLPVYDLGITGKGVRVLILDDGIEYTHEDLWENYDPEISYDANDEDD
DPFPRLDEEGSNAHGTRCAGEVAMKANNLKCGVGVAFNARVGALRLLDGEVNDRIEGIAL
GYAYDKVDIYSASWGPTDDGKTVEGPGRLAKEAIERGVTEGRNGKGVIYVWAGGNGGSKD
DNCDCDGYIGSIYTLSIGSASQHGQFPWYGEKCAATMAATYSSGAYADQMIATTDVGNTC
TIKHTGTSASAPLAAGIIALALEANSDLTWRDIQHLVAWTSEYSPLSENEGWVMNAAGFW
VNTRFGFGLMNAYSLVAAAINWTNVPEKYSCSIEAGKKSEEIYWGKDVNLEINATVCDYV
YYLEHVELEINIEYPVRGNLEIFLESPSGTNIQLLGRRKNDSSKRGFKNWKLMSVLTWNE
NPRGIWKVTVTDKIGTAKQKGRTGKFILHLHGLYDRPKYLENQNLNTDNNKMNKKNELNT
IDIDDKYFGCKFLQKWMP
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattcttctggtctttcattacaatatttttgattttaaaatttacaatttct
gctcataatggtgaagaacatacaaaatattattcaaatgaatgggtgataagattagaa
gggggccaagatgtagcagaattaatatcagctaaattgggttataaattattgggaaag
gttacaggatttaatgatacttacagaatcataaaagaagacattttcattcaaaaaaaa
agaaatcatgcgctacttacagaaacccttgaaaaagactcaagagtaatttgggccgaa
caacaattcactaaagaacgcgttaaacgaggatttttatacgataactctctgagtaca
gtgtataatgaaaataatgaaaaattaacgcgacaatcaattttaaacttattgaaagaa
aaaaatatatcatacaatcaagaaaaaattttatttaggccatctgatgttagcatgcga
tacgccagctacgatagatttaatgatgaactttggaaccaacagtggtatttgcaagat
acaagaacacaatcaaatttgccaaaattagatcttcatgttcttcctgtttacgacctc
ggcatcacaggcaaaggagtaagagttcttatattggacgacggtatagaatatactcat
gaagatctgtgggaaaactatgatcccgaaatcagctacgatgctaatgatgaggatgat
gacccttttccaagattagacgaagaaggaagtaacgctcacggtactcgttgcgccgga
gaagtagccatgaaagccaacaatctaaaatgcggtgtaggtgttgctttcaacgcaaga
gtgggagctttgcgattattagatggagaagttaatgacagaatcgaaggtatagccttg
ggttatgcttatgacaaggtagatatatatagtgcttcgtggggtccgacggacgatgga
aaaactgttgaaggacctggaagattggctaaagaggctattgaacgaggagtgacggaa
ggacgaaatggaaaaggagtaatttatgtttgggctggaggaaatggaggaagtaaagac
gataattgcgattgcgacggatacattggaagtatatatacattgtcaatcggaagtgct
tcacaacatggacaatttccttggtatggagaaaaatgtgctgctactatggctgctaca
tattctagtggagcgtatgcagatcaaatgatagctacgactgatgtaggcaatacgtgt
acaattaaacacacgggtacttcagcatcggcaccactcgcggcaggcatcatagctctt
gccttagaagcaaactcagatttaacatggagggatattcagcatttggtagcatggaca
tcagaatacagtccgttaagtgaaaacgaaggatgggttatgaatgcagctggattttgg
gtgaacacgagatttggtttcggtcttatgaatgcttatagcttagttgcagcagccatt
aactggacaaatgtaccggaaaaatattcatgttcaattgaagctggaaaaaaaagcgaa
gaaatttactggggtaaagatgtaaatttggaaataaatgcaaccgtttgcgattatgtt
tactatttagaacacgttgaattggaaattaatatagaatatccagttagaggaaatttg
gaaatttttttggaatctccatcaggaacaaatattcagttgctggggagaagaaaaaac
gatagttcaaaaagaggttttaaaaattggaaacttatgtcggtattgacatggaatgaa
aatccacgtggaatttggaaagttactgtcactgataaaattgggactgcaaagcaaaaa
ggacggacgggaaaatttattttacatcttcacggattatatgatcgaccgaaatatttg
gaaaatcaaaatttaaacacggataataacaaaatgaataaaaaaaatgaattaaataca
attgacattgatgataaatattttggatgtaaatttttacaaaaatggatgccgtaa

DBGET integrated database retrieval system