KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM247280Help
Entry
Phum_PHUM247280   CDS       T01223                                 

Definition
triosephosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phum_PHUM247280
   01230 Biosynthesis of amino acids
    Phum_PHUM247280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM247280
   00051 Fructose and mannose metabolism
    Phum_PHUM247280
   00562 Inositol phosphate metabolism
    Phum_PHUM247280
Enzymes [BR:phu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Phum_PHUM247280
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Phum_PHUM247280
  Exosomal proteins of bladder cancer cells
   Phum_PHUM247280
  Exosomal proteins of melanoma cells
   Phum_PHUM247280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 247 aa AA seqDB search
MGRKFWVGGNWKMNGTKNSIEEIANFLKKGPLDPNTEVVVGVPAVYLNFAKEKLPENVEV
AAQNCYKVPKGAFTGEISPSQLLDNNIHWVILGHSERRNIFGESDELVAEKVKHALEENL
CVVACIGEKLEEREAGQTEAVVFRQTKAIADKISDWSKIVLAYEPVWAIGTGKTATPEEA
QKVHNALRKWLKENVSEKVSEELRIVYGGSVTSSNCKDLAKEKDIDGFLVGGASLKPEFV
EIVNARK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggaaattttgggttggtggaaattggaaaatgaacggtactaaaaattctatt
gaagaaatagcaaattttttaaaaaaaggaccacttgatccaaacactgaagttgtagtt
ggagttcctgctgtttatttaaattttgctaaagaaaagctacctgaaaatgttgaagtt
gctgctcaaaattgctacaaggttcctaaaggtgcctttactggtgaaataagtccatca
caacttttagataataatattcattgggttatattgggtcattctgaaagaagaaacata
ttcggagaatccgatgaacttgtggcagaaaaagtcaaacatgcattagaagaaaatctt
tgtgttgttgcttgcattggtgaaaaattagaagaaagagaagcaggtcaaacagaagct
gtcgtttttagacaaacaaaagccatcgcagataaaatttcagactggtcaaagatagta
ttggcatatgaaccggtttgggcgattggaactggaaaaactgccacaccagaagaagct
caaaaggttcacaatgctttgagaaagtggcttaaagaaaatgtatcggaaaaagtatca
gaagaattgagaattgtttatggaggctcagtgacaagttcaaattgtaaagatttagca
aaagaaaaagatattgatggatttttagtcggtggagcatcattgaaaccagaatttgtc
gaaattgttaatgctcgaaagtaa

DBGET integrated database retrieval system