KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM249390Help
Entry
Phum_PHUM249390   CDS       T01223                                 

Definition
Replication protein A 32 kDa subunit, putative
Orthology
K10739  
replication factor A2
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Phum_PHUM249390
   03420 Nucleotide excision repair
    Phum_PHUM249390
   03430 Mismatch repair
    Phum_PHUM249390
   03440 Homologous recombination
    Phum_PHUM249390
   03460 Fanconi anemia pathway
    Phum_PHUM249390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 208 aa AA seqDB search
MDQWSDNRGGYFVGNEPTTPNQSVSSAIRQQFLCPVTVRQVLEAPEQGLKVGSLTATMVS
LCGVVSNVEITSTTIKFSLTDDTGIIDCLEWLETQDNSKISKTTNLLENNYYHVYGCVKY
PQGSRRIMVFKTVKVTDFNEITAFMLEVLSTNEYAEKTTKDSKVPATNAFGQNSFTSFNI
STDDRNKLTPIQKAIMDAISGGQDMNQG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatggagtgataatagaggaggatattttgtgggaaatgagcccactactcct
aaccaatctgtatcttcagctatcagacaacaatttttgtgtcctgttactgtcaggcaa
gttttagaagctcctgagcaaggtttaaaagtaggatccttgacagctactatggtatca
ctttgtggagtagttagtaatgttgaaataacatcaacgactataaaatttagtttaact
gatgacacaggaataatcgattgtttagaatggctggaaactcaggataacagtaaaata
tctaaaactacaaatcttttagaaaataattattatcatgtttatggttgtgttaaatat
ccccaaggaagtagaagaataatggtgtttaaaacagtcaaagttactgattttaatgaa
ataactgcatttatgttagaagttttaagtaccaatgaatatgctgaaaaaacaaccaag
gattctaaagtaccagccacaaatgcatttggtcaaaattcattcacttcatttaatatt
tccactgatgatagaaacaaactaacaccaattcaaaaagcaattatggatgccataagt
ggtggtcaagatatgaatcagggttaa

DBGET integrated database retrieval system