KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM249410Help
Entry
Phum_PHUM249410   CDS       T01223                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Phum_PHUM249410
Enzymes [BR:phu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Phum_PHUM249410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 256 aa AA seqDB search
MNNRNEDHSVSKGKTMPLTFRTLSWSECRNQDDIEIPGTPRTPRTSTTPGHENCTFHHDL
ELDHRPPTREALLPDMARSYRLLLEGLGEDPDRQGLLKTPERAAKAMLFFTKGYDQCLEE
VLNDAIFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCKKILGISKLARIVEIF
SRRLQVQERLTKQIAKAVTKAVQPAGVAVIVEGVHMCMVMRGVQKINSKTVTSTMLGEFR
DNPKTREEFLTLVQSK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgaaatgaagatcatagtgtttcaaagggtaaaacgatgcctctcacattt
agaacgttatcatggtctgaatgtagaaaccaagatgatatagaaattccgggaactcct
cggactccccggacatccacgactccaggtcatgaaaattgtacatttcaccatgattta
gaattagatcataggcctccaacaagggaagcacttcttcccgacatggcaagatcgtat
cgtcttttgttggaaggtttgggtgaagatcctgacaggcagggactattgaaaacgcca
gaaagggcggcgaaagcaatgttattttttacgaaaggttacgaccaatgcctggaagaa
gttttaaacgatgcaatttttgatgaagatcatgatgaaatggttgttgttaaagatata
gaaatgttttccatgtgtgaacatcatttggtaccgttttacggtaaagtttcgattggt
tatttaccttgcaaaaaaattttgggtataagcaagttagcaagaatagtggaaatattc
agtcgtcgtttacaggttcaagaaaggcttaccaaacagatagcaaaagcagtaacaaaa
gcagtacagccagcaggagtagctgtaattgttgaaggagtacacatgtgtatggtgatg
agaggggttcaaaaaataaatagcaaaactgtaacatcaaccatgctaggagaatttcga
gacaatcccaaaacaagagaagaatttttgactcttgttcaatcaaaatga

DBGET integrated database retrieval system