KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM249690Help
Entry
Phum_PHUM249690   CDS       T01223                                 

Definition
mitochondrial 28S ribosomal protein S18B, putative
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Ribosome [BR:phu03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Phum_PHUM249690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 181 aa AA seqDB search
MSITRIVGNNFLNVFRRTITTSGFCRTEDKESETEEKKLNPKDRSKVISVETSIAYLKSD
AYGEDFVWKHYRRNFKGHLPPRTRKTCIRKNVISTGSPCPICRDEYLVVDYQNIELLKHF
ISPDNGTIFESKKTGVCQVQHYKIKLAILKAQNYGLLSYEVPFRKYDYDYYQDTISESAN
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataacgagaattgttggaaataattttcttaacgttttcagaagaactattaca
acttccggtttttgtagaacagaagataaagaatcagaaacggaagaaaaaaaacttaac
ccaaaagatagatctaaagtaataagcgttgaaactagtatagcatatttaaaaagtgat
gcttatggtgaagattttgtatggaagcattacagaagaaatttcaaaggacacttaccg
cctcgtactagaaaaacatgtattagaaaaaatgtaatatcaaccggaagtccttgtcct
atatgcagggatgaatatttggtggtcgattatcaaaatattgaattactaaaacatttt
atttcacctgataatggaacaatatttgaatctaaaaaaactggagtttgccaagttcaa
cactacaaaattaaattagcaattttaaaagctcaaaattatggtttattaagttatgaa
gttccctttagaaaatatgattatgattattatcaagatacaattagtgaatcggcaaac
aattaa

DBGET integrated database retrieval system