KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM251300Help
Entry
Phum_PHUM251300   CDS       T01223                                 

Definition
Alkaline phosphatase, tissue-nonspecific isozyme precursor, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 582 aa AA seqDB search
MKNICHFSPPPPRIPRSKKLTQFSNREFWYEEARSALRRRLQQNPPSVGSKTHARNVILF
VGDGMSLTTITASRILKGQRGGRSGEEQDLAWDKFPAVALVKTYNADAQVGESSACSTAL
MCGVKANFETLGLDTRGKFENCLSSFSSKVPSLMDWAQEEGKMTGIVTNTRITHATPAAL
YAHTPSRYWEDDGKVPPASRKSCKDIARQLIEDDPGKNINVILGGGRRHWLPKVAKDPES
DKDEGRRLDGRNLIDDWIRDKKRRGLNSAYVWNKSQMEEINKKQIDHLLGLFSYSHMDFE
TDRNTGPDGDPSLADMTRTALNMLQKSTKGFFLFVEGGRIDHAHHYNNAYRALDETIALE
SAVLTAMSMVDLSETLIVLTSDHSHVMTMGGTDGKVSDIDGFPYSTLIYGNGPGFSEPRT
IPNNGTTVGKQAEEKNSVHGAAVPRQWATHGGEDVPIYAQGPLASSVFTGVIDQSYIPHA
IAYAACWGFHSHRCSNGLDNYTTSQVQTACSSLPDVSSASTGSHGSGQPIVIASSVMSDN
GRSNFMGTIYVYFIYYQVFNIFYNNLININIIIIIIIIIINN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatttgtcacttttcccctccccccccccgaattccaaggagtaaaaaattg
actcaattttcaaatcgagaattttggtacgaagaagcgcgatcggcgttaagacgtaga
ctccagcaaaatcctccaagtgtcggatctaaaactcatgcaagaaacgtcatcttgttc
gttggtgatggtatgagtttgacaacgataacagcatcaagaatattaaaaggacaaaga
ggaggaagatcgggtgaagaacaagatttagcctgggataaatttccagctgttgcttta
gttaaaacgtataacgcagatgctcaggtaggagaatcatcagcttgttctacggcatta
atgtgcggagttaaagcaaattttgaaactttaggattggacacgaggggaaaatttgaa
aattgtttatcaagtttttcatccaaagtgccttctttaatggactgggcacaggaagaa
ggtaaaatgactggtatcgtaacaaacacgagaataactcatgcaacaccggcggcatta
tacgctcacacaccaagtagatattgggaagatgatggaaaagtacccccagcatcaagg
aaatcatgtaaggatatagcgagacaattgatagaagatgatcctgggaaaaacataaac
gtaatattaggcggtggtagaagacattggttaccaaaagtagcaaaagatccggaatct
gataaagatgaaggaaggagattagatggtagaaatttaatcgatgattggattcgtgat
aaaaaaagacgaggacttaattccgcttacgtgtggaacaaatcacaaatggaagaaatc
aataagaaacaaattgatcatttattggggcttttttcatattctcacatggattttgaa
acggatcgtaatactgggccagatggggatccgtctttagccgatatgacaagaacagct
ttaaatatgttgcaaaaaagcacgaaaggattttttttattcgttgaaggaggaagaatc
gatcatgctcatcattataataatgcgtacagagcattagatgaaacgatcgcattagaa
tccgcggttttaaccgccatgtctatggtggatcttagtgaaactttaattgttcttact
tccgatcattcgcacgtgatgacaatgggaggtacggatggaaaagtttccgacatcgat
ggatttccttattccacgttaatttacggtaacggacctggttttagcgaaccgagaacg
attccaaataatggtacgaccgtcggaaaacaagcagaagaaaaaaattcggtacacggt
gctgccgtacctagacagtgggcaacacacggtggagaagatgttccgatttacgcccag
ggacctttggcctcgtcggtattcaccggggtcatagatcaaagttacatacctcatgct
attgcatatgccgcgtgttggggatttcacagtcataggtgtagcaacggtttagataat
tacactacatctcaggtacaaacggcttgttcgtctttaccggatgtgagtagcgcatcg
acgggttcacacggttcagggcagccaatcgtaattgctagttccgttatgtctgataat
ggacgttcgaattttatgggaactatttacgtttattttatttattatcaagtttttaat
attttttataataatttaataaacataaatataataataataataataataataataata
aacaattaa

DBGET integrated database retrieval system