KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM258020Help
Entry
Phum_PHUM258020   CDS       T01223                                 

Definition
core 1 UDP-galactose:N-acetylgalactosamine-alpha-r beta 1,3- galactosyltransferase, putative
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Phum_PHUM258020
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Phum_PHUM258020
Glycosyltransferases [BR:phu01003]
 Glycan extension
  Type 3 chain
   Phum_PHUM258020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MRAKVSIKRSSVFTLLTGVIFGFSFAYILFYTSNNYITWTLPVENFKSYLQQIPLSRDDG
SSNDVVANHVGHETENYLAKQLSEKVKLLCWIMTQPASHEKKAKHVKNTWGRRCNYLIFM
STEADYRLPAVRLKVKEGRNALWAKTKEAFKYVYQHYMDRVDWVLKADDDTYVIVENLRL
VLSQHNSSEKLYMGCRFKPYTKNGYMSGGAGYVLSKEAVKAFVEEALPSSKCRQDGEGAE
DVEIGKCLEAVGVSAIDTRDSYGRHRFLPLPPVYYLVPKALPKTNWFWQYTYYPMKEGFE
CCSDTSVSFHYISPNEMYLLEYLIYHIRPYGISQNIISPSPSKESFYPSQTSSYNKLTST
GTNDRSTEFSKRTSPPSDIESNLV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctaaagtgagcataaagcgctccagcgtctttacattacttacgggggttatt
tttggattcagttttgcttatatacttttttatacttccaataattatattacatggact
ttaccagtagaaaattttaaatcttatttgcaacaaattccactttcgagagatgatggt
tcgtcgaatgatgttgtcgccaatcacgtcggtcacgaaacagaaaattatttggcaaaa
caattatcggaaaaagttaaacttctttgttggattatgacacaaccggcttcccatgag
aaaaaagctaaacacgttaaaaatacatggggtagaagatgtaattatttaatttttatg
agcactgaagcagattataggcttcctgcggttaggcttaaggtgaaagaaggtcgaaat
gccctttgggcaaaaacgaaggaagctttcaagtatgtttatcagcactacatggatcgg
gtggactgggtgctaaaggctgatgatgatacgtatgttatagtcgaaaatttaaggctc
gtcctttcccagcacaattcatctgaaaaattatatatgggatgtcgtttcaaaccgtat
acgaaaaatgggtacatgagcggcggagccggttatgtactcagtaaagaagccgtcaaa
gctttcgtggaagaagctttaccaagttcaaaatgtcggcaagatggggaaggtgccgaa
gatgtcgaaataggtaaatgtttggaagccgttggagtttctgcgatagacacaagagat
tcctatggtcgacacaggtttttgcctttaccaccggtttattatttagtacccaaagca
ttacccaaaacaaattggttttggcaatacacttattatcccatgaaagaaggtttcgaa
tgttgttccgacacatcggtatcgtttcattacataagtccgaatgaaatgtaccttttg
gaataccttatttatcacataagaccttacggaataagtcaaaatattatttcaccttca
ccttcaaaagagtcgttttacccttctcaaacttcatcgtataataaacttacatcgaca
ggaacaaatgatagatcaacagaattttctaaaaggactagtccaccgagtgatattgaa
tcgaatttagtctga

DBGET integrated database retrieval system