KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM268810Help
Entry
Phum_PHUM268810   CDS       T01223                                 

Definition
Cytochrome c, putative
Orthology
K08738  
cytochrome c
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Phum_PHUM268810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 106 aa AA seqDB search
MGEGNVEKGKKIFVRSCSQCHTVEKGGKHKVGPNLNGLIGRKTGQSPGYTYTDANKSKGI
TWNSETLFLYLENPKKYIPGTKMVFAGLKKAQERHDLIAYLEEATK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaggaaacgtagaaaaaggtaaaaaaattttcgttagaagttgctctcaatgt
cacacagttgaaaagggtgggaaacataaagttggcccaaatttaaatggtttgattggt
agaaaaactggtcaatctccaggttacacatatactgatgcaaataagtctaaaggaatc
acttggaacagtgaaactttatttttataccttgaaaaccctaagaagtatattcctggc
acaaaaatggtttttgctggccttaaaaaggctcaagaaagacatgacttgattgcctat
cttgaagaagctaccaaataa

DBGET integrated database retrieval system