KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM268820Help
Entry
Phum_PHUM268820   CDS       T01223                                 

Definition
Phosphatidylinositol 3-kinase tor2, putative (EC:2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Phum_PHUM268820
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   Phum_PHUM268820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2456 aa AA seqDB search
MSNALMQQFVSGLKSRHADVRMKTAKDLYLYVKTELREVSPEELTAFMDEFNRHIFEMVS
GSDVNEKKGGILAIECIIGVDIGNTSTRISRFMNYLRNLLPSNDVGVMELAARTVGKLAL
VSGTCTAEYVEFEVKRAFEWLGSERHENKRHAAVLVLKELAISMPTYFFQQVQLFFDLIF
NAIRDPKAVIREAGVDALRAALVVIAQRETTKQAQRPQWYKQCFDEAKQGLEDVYVREKG
FNRDDRVHGALLVLNELLRCANNKWERLQEELNSKLFNPTSKTNHQTEGMNLLPRLKYPL
GRNQKSMALVISGSNHNQIMCESSACKQLVSEKMDEICTEALAQRLSRSPYVQQALLALL
PRLAAFNKDKFVSMHLHGSMSYLLASLRGREKERALSFTTIGLVAVAIQDGIRPYLPKIM
EFLKVSLPVSKDITTKKRGPPGPEPGVLVCITLLGHAVPNLVKDDVRDLLEAMLATGLSP
GLTTALRELAATVPQLKRDISEGLLKMLSQVLMHKPLRHPGTPRHALMGPSPPQGNFFYF
QMFSDPQDTASTTLALRTLGSFNFEGHSMLQFVRRCADHFLTSDLQEVRLETVRTCSRLL
RLALQGRRSETVNSTVADVLSKLLTVGITDTDPEVRYWVLESLDSSFDQHLAQAENISAL
LVAMNDEIFEIRELAVSTIGRLSTLNPAYVMPSLRKTLIQFLTELEHSGMGRNKEQSARM
LDKLIVSSPRLVRPYMEPILKILVPKLREAEPNPAVVVHILTAIGDLSEVNGAAMRSWAD
ELLPILLELLGDSSSPERRGVALWCLGQLVGAAGLVVTPYHKYPTLLDVLINFLKTEQQP
AIRRETIRVLGLLGALDPYRHKLNQGQIDSQAHSTSFFANKDLKNEESNLELNTSEMLVN
SSAATLEEFYPAAAVTTLMRIIRDPTLAQHHTMVVQAVTFIFNSLGIKCVPYIGQVMPSL
LHVIRNSDVGFKEFLLQRLGDLISIVKQHIRNYLDDLFLLIKEFWTPNSPLQGTLISLVE
AIAIALGAEFKVYLPQLLPQILRVLTHDTSKDRLVTMKLLSCLENLGSNLDDYLHLILPP
VVRLFDARDCPSAVCKHAFETVDRLAEILDFSDFASRIIHPLARALDTSPELRQVAIDTL
CALVTQLGKKKYSIFEPLIHKVMTKHKIQSPRYEMVWSNVQNDKISEDGEIDLNFYKSTL
PRNRNKGSDPSQSDSTTFKRLHVSAVNLQRAWTASRRVSKDDWLEWLRRLSIELLKESPS
PALKSCWALAQTYSQLPRDLFNAAFVSCWTELNDSLQKELIQSLEQALLVPDLPELTQTI
LNLAEFMDHCDNKALPIDPILLGERAMHCRAYAKALHYKEEEFHRQKTPNTQIYEALISI
NNKLQQKEAAVGLLEHILSIQGAGEPLRDQEIWYEKLHNWEKAKAAYQERLDENPHDVEF
TLGQMRCMEALGEWDQLHDVANKHWSNWNDEGRQRMSRMAAAAAWGLGKWDSMEQYVSCI
PQDSQDGAFFRAVLAVHREHFAVAQQFIDSARDLVDTELSALAGESYQRAYGAMVQVQML
AELEEVVQYKLVPERRPIIRQIWWERLSGCQRVVEDWQKIIQVRTLVISPQEDVHTWLKY
ASLCRKANRLMLSHKTLVMLLGKDPSGDLDAVLPTQNPNVTFAYTKHMWVAGCREQAYNQ
LYRLVHSCLRPQIQQCNKEMDEQKRLLARCYLKLGEWQEALQGVNEKSIAAVLLCYAAAA
DHDPQWYKAWHAWAYMNFETVLFYKHQHQDGSGEQKSGTLKNTEGREAFIYKFAAPAVEG
FVRSISLSKGSSLQDTLRLLTLWFDYGQYTDVYDAIVSGLNIIEIDTWLQVIPQLIARID
TPRALVSMLIHQLLIDIGKNHPQALVYPLTVANKSASSFRRTAANKILKSMCEHSPVLVQ
QAVMVSDELIRVAILWHELWHQGLEEASRLYFGERNVKGMLDTLEPLHAMLERGPQTLKE
TSFNQTYGRDLTVAQEWCHRYKQSGNVRDLNQAWDLYYHVFRRIARQLPQLTSLELQYVS
PKLLLCRDLELAVPGSYAPGQPIVRITHIQPALQVISSKQRPRKLGIKGSNGADYMFLLK
GHEDLRQDERVMQLFGLVNTLLLHDSDTFRRNLTIQRYAVIPLSTNSGLIGWVPHCDTLH
TLIRDYREKKKILLNIEYRIMLRMAPDYDHLTLMQKVEVFEHALETTQGDDLARLLWLKS
PSSELWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMT
REKFPEKIPFRLTRMLINAMEVTGIEGTYRKTCESVMSVLRHNKDSLMAVLEAFVYDPLL
NWRLMESTPKTKRSKQTTDSSISSSAQEGDGMDGTDSLAPSLPKKGAPTTSSQDNGDKNQ
PEALNKKALAIVTRVRDKLTGRDFCSEETLEVPKQVSFLIYEATSNENLCQCYIGW
NT seq 7371 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgctcttatgcagcaatttgtttctggtttaaaatctcgtcatgccgatgtt
cgcatgaaaactgccaaagacctatatttgtacgtaaaaacagaattgcgagaagtttct
ccggaggaacttacagcttttatggatgaattcaaccggcatatattcgaaatggtctcg
ggatctgacgttaatgaaaaaaaaggcggtatattggcaattgaatgcattattggtgta
gatattggaaatacgagtactagaatttcccgattcatgaattatttaagaaatttactt
ccatccaacgatgtaggagtaatggagcttgcagcgcgaaccgttggaaaactagctttg
gtatccggcacttgtacagcggaatatgttgaatttgaagttaaaagagcttttgaatgg
ttaggaagtgagaggcatgaaaataaaagacatgctgctgttttagttttaaaagaattg
gccatatcaatgcctacatatttttttcaacaagttcaattgttttttgacttaatattt
aatgcaataagagatccaaaagctgtcattagagaagcaggtgttgatgctcttagagct
gctttggtagtaatagctcaaagagaaacaactaaacaagcacaaagaccacaatggtac
aagcagtgttttgatgaggctaaacaaggattggaagatgtatatgtcagagaaaaggga
ttcaacagagatgatagagttcatggagcattactggtacttaatgagcttcttaggtgt
gcaaataataaatgggaaagactacaagaagagctcaattctaaattgtttaacccaaca
tccaaaactaatcatcaaacagaaggaatgaatttgttaccaagattaaagtatccttta
ggtcgaaatcaaaaaagtatggcattggtaatatccggttctaatcacaaccaaattatg
tgtgaaagttctgcttgtaagcaacttgtatctgaaaaaatggatgaaatttgtactgaa
gctttagctcaaagactatctaggagtccttatgtacaacaagctcttttagccttattg
ccaagattagctgctttcaacaaagacaaatttgtttccatgcatcttcatggtagtatg
agttatctactggctagcttgcgaggtcgtgaaaaagaaagagcattgtcttttacaacg
atcggactggtggctgttgctattcaggacggtattcggccgtatttgcctaaaataatg
gagttcttgaaagtatctttgcctgtttctaaagatattacaactaaaaaaagaggaccc
cctggacctgaaccaggcgttttggtttgtattacgctgttaggccatgccgttcctaat
ttggttaaagatgatgttagagatcttttagaagctatgttggctactggattaagcccc
ggtttaacaacggctctgagagaacttgccgcaactgtgccacaactaaagagagatata
tctgaaggccttttaaaaatgctttctcaagtgttaatgcacaaacctttgcgacatcca
ggaactcctagacacgccttaatgggtcccagcccacctcagggaaatttcttttacttt
caaatgttcagtgatcctcaagatacagctagtacaactctagccttacggactttggga
agttttaattttgaaggtcacagcatgctgcaatttgtaaggcgatgcgctgatcacttt
ttgaccagtgatttgcaagaagttcgtcttgaaacagttagaacatgcagtcggcttttg
agattagcattacagggaagaagatccgaaaccgttaattcaacagttgcagacgttttg
tccaagttattgaccgtagggataacggatacggatccggaagttcggtattgggtgtta
gaatcattagattccagtttcgatcaacatcttgcgcaagcagaaaatatcagtgcgtta
ttagttgccatgaacgatgaaatatttgaaattagagaattagccgtgagcacaattgga
agacttagtactcttaatccggcttatgtgatgccatctttaagaaaaacattaattcaa
tttctcaccgagttagagcatagtggtatgggaaggaataaagaacaaagtgctagaatg
cttgataaattaattgtaagctctccgagactggttagaccgtatatggagccaatttta
aaaatattggtgcctaagctccgtgaagcagaaccgaatccagcggtggttgttcatatt
ttaacagctattggagatttatctgaggttaatggtgcagccatgagatcatgggctgat
gaattgcttcctattctgttagaacttttgggggatagcagttctcctgaaagacgaggc
gttgctttatggtgtcttggacagttagtcggtgcagccggtttagtcgttacaccctac
cacaaatatccaactttactagatgtattaatcaactttttaaaaactgaacaacaacca
gccattcggagagagacgattcgtgttttgggactattaggtgcacttgatccttatcgt
cataaattaaatcaaggacaaatcgactcgcaagctcattcgacttctttttttgcaaac
aaagatttaaaaaatgaggaatcaaatttagagctgaatacaagtgaaatgctagttaat
tctagtgcggcaacattggaagaattttatccagcagctgcggtaaccactctaatgcga
attatcagagatcccacgttggctcaacatcatacaatggttgttcaggctgtaactttc
atttttaactctcttggaattaaatgcgtgccctacatcggtcaagttatgccaagttta
ctacatgtaatccgaaattcagatgttgggtttaaagaatttttacttcaaagattgggc
gatttgatttcaatcgtaaaacaacacattcgaaattatttggacgatctatttctcctg
ataaaggaattttggacaccgaatagtccgttacagggaactttaatatccttggttgag
gcgattgccattgctttaggagcagaatttaaagtttatttacctcaattattaccacaa
attttacgagttttaactcatgacactagtaaagatcgtcttgttacaatgaaattgtta
agttgtttggaaaacttgggaagtaacttggatgattacctccatttaattttaccacca
gtagtccgattattcgacgcccgggattgtcccagtgcagtttgcaagcacgcttttgaa
acggttgaccgtctagctgaaatattagatttttcagacttcgcttctagaataattcat
cctttagcaagagcgttagacacaagtccagagctcaggcaagtggccatagacacactt
tgtgctcttgtcacccaattgggcaaaaaaaaatattccatatttgagccattaattcac
aaggttatgactaaacataaaattcaatcaccaagatatgaaatggtttggtcaaatgtt
caaaacgataaaatcagtgaggatggcgaaatagatttaaatttttataaaagtacttta
cctagaaatagaaataaaggatccgatccaagccaatcggattctactacttttaaaagg
ttacacgtttcagcagttaatttgcaaagagcatggacggcgagtagaagagtttcaaaa
gatgattggttagaatggttgcgaagattaagtattgaattattaaaagaatctccttct
cctgccttaaaatcttgttgggcgttagcacaaacatattctcaacttcctcgagacctt
ttcaatgctgcatttgtttcttgttggactgaattaaatgattctttacaaaaagaatta
attcaaagtttagaacaagcattactcgttccagatctaccagaattaactcagaccata
cttaacctcgccgaatttatggatcattgtgataataaggctttgcctatcgaccctatt
ttgctcggggaacgtgccatgcattgtcgagcctatgcaaaagctttgcactataaagaa
gaagaatttcataggcaaaaaactcccaatactcaaatttatgaagctttgatttcaatt
aacaataaacttcaacaaaaagaagcagccgtcgggctgctggaacatatattaagtatt
caaggagcaggggaacctctcagagatcaagaaatatggtatgaaaaattacacaattgg
gaaaaagcaaaagcagcttatcaggaaagattagatgaaaatccacacgatgttgaattt
actttgggacaaatgagatgcatggaagctcttggagaatgggatcaattgcacgatgta
gcaaataagcactggtctaattggaatgatgaaggacgccaaagaatgtcaagaatggct
gcagcagctgcttggggtcttggtaaatgggattcgatggagcaatacgttagttgtatc
cctcaagattcacaggatggagctttttttagggctgtcttggctgttcatagagagcat
tttgccgtagctcaacaatttattgattcagctcgagatttagttgatacagaactttca
gcattagctggagaaagttatcaacgtgcttacggagctatggttcaagtacaaatgttg
gcagagctggaagaagtagttcaatataaacttgtgcctgaaagaagacctattattaga
caaatatggtgggaaaggctttctggctgccaaagagttgtagaagattggcaaaaaatt
attcaagttcgtactctagtaataagtcctcaagaagatgtacatacctggctcaaatat
gcttctctatgtcgaaaagctaatcgtctgatgctgtcgcataaaacactagtaatgctt
ttgggaaaagatccttctggagatctggatgctgtacttcctactcaaaatccaaatgtt
acttttgcatacacaaaacatatgtgggtggcaggatgtagggagcaagcctataatcaa
ttgtatcgactggttcactcctgtttaagaccacaaattcaacaatgtaacaaagaaatg
gatgagcaaaaaagacttttagcaagatgttacttgaagctcggtgaatggcaagaagcg
ttgcaaggcgtaaatgaaaaaagtattgctgcagttttgctgtgttatgcagctgctgca
gatcacgatcctcaatggtataaagcgtggcatgcttgggcttatatgaattttgaaacc
gttttattttataaacatcagcatcaagacggttcgggtgaacagaaatcaggaacttta
aaaaataccgagggaagagaggcatttatatacaaatttgctgctcctgctgttgaagga
ttcgtaagatctatatctttatcaaaaggtagctctttacaggatacacttcgattattg
acgctatggtttgattatggacaatacacagatgtttatgatgccattgtcagtggacta
aatataattgaaattgatacctggttacaagtcatacctcaactcatagctcgaatagat
actcctagagctttagttagcatgttaattcatcagttactaatagacatcggcaaaaat
catcctcaagctttagtgtatccgttaactgttgctaataaatctgccagctcgtttcgc
cgaacagcagcaaacaaaattttaaagtcaatgtgtgagcatagtcctgttttggtacag
caagctgtcatggtttctgatgaacttattcgtgtagcaattttgtggcatgaactttgg
catcagggtttggaggaagctagtcggttatattttggagaaagaaatgttaagggaatg
ttggatacgttagaacctcttcacgcaatgcttgaaagaggtccacaaactcttaaggag
acttcttttaatcagacttacggtagagatcttacggttgctcaagagtggtgtcatagg
tataagcaatcgggaaatgttcgagatttgaatcaagcttgggatttatactatcacgtt
tttcgtcgtattgcgagacaattacctcaattgaccagtttagaattgcaatatgtgagt
cctaaattacttttatgtcgagacttggaattggctgtacccggaagttatgcaccaggt
caacctattgtcagaataactcatattcaaccggctttacaagtaatcagttccaaacaa
cgtcccagaaaattaggaattaaaggaagcaacggagcagattacatgttccttttaaaa
ggtcacgaagatcttcgacaagacgaaagagttatgcaattgtttggcctcgtaaacact
ttacttcttcatgattccgatacatttcgccgaaatttgacaatccagaggtacgcagtt
attcctctttcaacgaatagcggtctcatcggttgggtccctcattgcgatacattacat
acacttatacgagactacagggaaaagaaaaaaattttacttaatattgaataccgaata
atgcttagaatggctcccgactacgatcatttaactttaatgcaaaaagttgaagttttt
gaacatgctttagaaactactcaaggagatgatttggctcgattattatggctaaaatcc
ccttcgtctgaattatggtttgatagaagaacaaattatactagatctcttgccgtaatg
tcaatggttggttacattctcggtttaggagatcgacatccttctaatcttatgctggat
agattaagtggtaaaattttgcatattgattttggggattgctttgaagtcgccatgaca
agggaaaaatttccagaaaaaattccatttagattaacaagaatgttaattaacgcaatg
gaagttacgggaatcgaaggaacgtacaggaaaacatgcgaatccgtcatgtccgtttta
agacataataaggacagtttaatggctgtcctagaagcattcgtttacgatcctcttctt
aattggagattaatggaatcaactccaaaaacgaaaagatcaaaacaaacgacggattca
tccataagttcttcagctcaggaaggtgatggaatggatggtacagattcattggctcct
tcattgcctaaaaaaggagctccaactacctccagccaagataatggtgataaaaatcaa
cctgaagcattaaataaaaaagctttggccattgtgactagagtaagggataagttaact
ggtcgagatttttgttctgaagaaactttagaagttcccaagcaagttagttttctcatt
tacgaagcaacatcaaatgaaaatctctgtcagtgctatatcggatggtaa

DBGET integrated database retrieval system