KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM280670Help
Entry
Phum_PHUM280670   CDS       T01223                                 

Definition
cell division cycle, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Phum_PHUM280670
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Phum_PHUM280670
Ubiquitin system [BR:phu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Phum_PHUM280670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 728 aa AA seqDB search
MIVFEPVQAAIWHCLNHYSYDDAIFLAERLYAEVECDESLFLLATCYYRSGLISMAYSTL
KKKDAHSPQIRCLLAKCCVDLQKYAEAESILTGQSIMKSKEINDDDIISEFGDESCFVFK
ILAIIASKTHRIELTAEMYKKSLKLNPFLWHSFEQLCNLGYEPDPNDIFTVSKMENFTCC
HGINPVVNYVNNNLSEKNYPVNNSSSHNNMDLHYKSSSTPVQLMNVANSGTCAVRLFATP
EENIPMTPSSLGIATLSSIPSSKVKKNSRFRSMFSPIQIPSFGLLPFNFDTGSPADNSSA
LTPDIYDSKNRSLSNKETPLQQGKPVFSQSGNTSNTANIVNSNQSNSVTPPLQSVRRSTR
LFSSSCSVKENNKSPKHGKFVSPKSPSRKTKRGVSKTNLSINSFNEITVNNNEKNRNNDK
NNIPVEQITNEKNSVSISMQALQIQKDAAEGLMTLLRDIGTAYLNLSKFECLKAIECFNN
LSPSQRNTGWVLAMIAKAYYELPDYPNSIKYFRKVRETDPERLLLTELYSTALWFLQRSV
YSKQEKYELALAHYYMAESINPKNVVILCHIGVVQNARQKTESALNWLGKALAINPKSAL
CKFHRAKIYFNIGRHVEALKELEQLKQIVPKESLVYYLIGKLHKKLGNTHLALMHFSWAM
DLDPKGTHTQIKESIDPSLSRGPGEDGIISGQDTTAENEVDEGGSIEPNQQPPPEHHEQS
LQESDESF
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttttgaaccagttcaagctgccatttggcattgtcttaatcattattcatac
gatgatgctatcttccttgccgagcgactttacgcggaagttgaatgtgacgaatctcta
tttttattggctacatgctattatcgctcaggtctgatctcaatggcttactcaacttta
aaaaagaaagatgctcattcacctcaaataagatgcctactagccaagtgctgtgtagat
ctgcaaaagtacgcagaagctgaatccattttgactggacaaagtataatgaaatcaaag
gaaataaatgatgatgacataatatcagagtttggcgatgaatcgtgttttgtttttaaa
atattggccattattgcatcaaaaactcacagaatagaacttacagctgaaatgtataaa
aaatcattaaaattgaatccttttttatggcattcattcgaacaactctgcaacttaggg
tatgaacctgatccgaatgatattttcaccgtttctaaaatggaaaatttcacttgttgt
cacggaataaatcctgttgttaattatgtcaacaataaccttagcgagaagaactatcca
gtaaataattcatctagtcacaacaatatggatttacattataaaagttctagtactcct
gtacaattgatgaatgtggcaaactcgggaacatgtgctgtaagactttttgctaccccc
gaagaaaatatacctatgacaccaagttcattaggaatagctactttatcatctatacca
tcgtctaaagttaaaaaaaattcaagatttcgtagtatgttttcccctattcaaattcca
agtttcggtttgttaccattcaattttgacacgggtagtccagcagacaattcttctgcc
ttgacacctgatatatatgattctaagaatagatcgttatcgaacaaagaaactccattg
caacagggaaagccagtgtttagccagtctgggaatacaagcaacactgccaacatagtt
aattcaaatcaatcgaattcggtgactccccctttacaaagcgttcgaagatctacacgt
ttgttttcaagtagctgttccgtaaaggaaaataataaaagtccaaaacatgggaaattt
gttagtccgaaatcaccgtctagaaagacaaaaagaggggtctcgaaaacgaatttaagc
ataaacagttttaacgaaatcactgtaaataataatgagaaaaatcgaaacaatgataaa
aataatattcccgtcgaacagataacaaatgaaaaaaattccgtatctatatcgatgcaa
gcattgcaaatacaaaaagatgctgccgagggtcttatgacattattgagagatattgga
actgcttatttaaatttatcgaaatttgaatgtttaaaagcaatcgagtgttttaataat
ttatcaccatctcaaagaaataccggttgggttttggctatgattgctaaagcatactac
gaacttcccgattatccaaatagtataaaatatttccgtaaagtgagggaaacagatccg
gaaagattgttgttaaccgaattatacagcacggctctttggtttttacaacgctcggtt
tattccaaacaagaaaaatatgaattggcactggcacattattatatggcagaaagtata
aatcctaaaaacgtggttatattgtgtcacattggagtcgttcaaaacgcgaggcagaaa
acggaatctgcacttaactggcttggtaaagcattagcaattaatccgaaaagcgctttg
tgtaagtttcatagggcgaaaatatattttaatatcggtaggcacgtggaagcactcaaa
gaattggaacagctaaaacaaatagtacctaaagaatcactagtctattatctaattgga
aagcttcacaaaaaattaggaaatactcatttggcactcatgcactttagttgggctatg
gatttagatccgaaagggactcacacacaaataaaagaatccatcgatccgtcgttatcg
cgaggaccgggagaagacgggattatttccggtcaagatacgacggcagaaaatgaagtt
gatgaaggaggatcgatcgaacccaatcaacaacctcctcccgaacaccacgaacaaagc
cttcaagaatcagacgagagtttttaa

DBGET integrated database retrieval system