KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM281370Help
Entry
Phum_PHUM281370   CDS       T01223                                 

Definition
sphingosine kinase A, B, putative (EC:2.7.1.138)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Phum_PHUM281370
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Phum_PHUM281370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MDGSGVGSDTLLEETFYIFSKKNTVYKVKLTEKGLSLVKENNGQTKTETIRIDDIVGAHC
MRSKAKVQGGPCVCGPNSKKKDLKMVEDYGCEYDQRDVSAYLYVYAYILKKSKVTSGERR
EKMTITLRFRSFDKSQENMREAQRWRTAIKYLIKKKPIPDFVIYQGDQEIIASPTISFDE
SQKLLILLNPKSGPGKAKEMFHTKIAPVLTEAEIPYDLIITKHSNYARDFVRLKDIYQWS
GIVAVGGDGILFEIMNGIFERPDWEKVFSQVKLGVIPCGSGNGLAKAIAHSLSEPYNKNP
CLTSALNVTSGNVVDMDIVRVETKNDIMYSFLSIGWGLLADIDIESEKLRAIGSQRFSIW
SVAKLIGLRTYRGKIMFSRIDGLKKVTKDGNHLNGLYNNCSNEKYDDIKSMRMSQSLNDV
FSNVSEDNINLETSDNKGSKSPCSLHKSDSFYSIHSRYSTYFSVAGSSYLSTDEQTEDSI
EPRKPGNSVRMYGPASRLPSLTQPVPKNWDTVEGEFVMVQASYQTHIGSDCFIVPNAKLS
DGIIWLMFVKKGASRSQMLQILLGLSSGDHVASPQLEIIPVKAFRLEPDLTDGNSGHITV
DGECVDYGPIQAEIFPKMASIMSR
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggacggcagtggcgttggtagtgacactttgctcgaagagacattttatatattttct
aaaaaaaatacagtttataaagttaaactaaccgaaaaaggattatctcttgttaaagaa
aataatggtcaaacaaaaacggaaactatacgaatcgacgacatcgtcggtgctcattgc
atgcgaagtaaagccaaagtgcaaggaggaccgtgcgtttgcggtcctaattcaaaaaaa
aaagatttaaaaatggttgaagattatggttgtgaatacgatcagagagacgttagtgct
tatttgtacgtttacgcttatattcttaaaaagtctaaagttacgtcgggtgaaaggcga
gagaaaatgaccataactctaagattcaggtcttttgataaatcacaagaaaatatgaga
gaagcacaaaggtggagaacggcaattaaatatttaattaaaaaaaaacccatacctgat
tttgttatttatcaaggagaccaagaaattatagcatcaccaacaattagctttgatgaa
tcccaaaaattgttaattttattaaatccaaaatctggacctggtaaagccaaagaaatg
tttcatacgaaaatagcacctgttttgacagaagccgaaattccatatgatttgataata
acaaaacattcaaattatgctagagactttgtcagattaaaagatatttatcaatggagt
ggcatagttgctgtcggaggtgatggaatactttttgaaataatgaatggaatttttgaa
aggcccgattgggaaaaggttttttcacaagtcaaactcggtgtcattccgtgcggatct
ggaaatggtttagcgaaagccattgcacattccttaagtgaaccgtacaataaaaatcct
tgtcttacctctgcacttaatgttacaagtggaaatgtcgtagatatggatatagtgaga
gtagagacgaaaaatgacataatgtattcatttttaagtataggctggggtttgttggct
gacattgacattgaaagtgaaaaattaagagcaattggtagtcaaaggttttcaatatgg
agtgtggcaaaattaatcggattgagaacttatcgaggtaaaataatgttttcacgaata
gatggccttaaaaaagtaaccaaagatggcaatcatttaaacggtttatataataattgt
tcgaatgaaaaatatgatgatataaaaagcatgcggatgagtcagtcattaaacgatgtt
ttttcaaacgtttctgaagacaatattaatttagaaactagtgataataaagggagcaaa
tctccttgtagtttgcataaatctgatagtttttattcaatacatagtcggtacagtact
tattttagtgttgctggtagtagttatttaagtacggacgagcaaacagaagacagtata
gaacctcgaaaaccggggaatagcgtgagaatgtacggccctgcctccagactaccctct
ctcactcagccagtgccaaaaaattgggataccgtggaaggagaatttgtgatggttcaa
gccagttatcaaactcatatcggtagtgattgttttatagttcctaatgccaaacttagt
gacggtataatttggcttatgtttgttaaaaagggagcatccagaagtcaaatgcttcag
attttgttgggactttcctccggcgatcacgttgccagcccacaactcgaaatcattccc
gtgaaagcatttagattagaaccggatttaacggacggcaattcgggacacataacggtc
gacggggaatgtgtcgattacggtcccattcaagcggaaatttttcccaagatggcttcc
attatgtcaaggtaa

DBGET integrated database retrieval system