KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM284180Help
Entry
Phum_PHUM284180   CDS       T01223                                 

Definition
serine/threonine-protein kinase minibrain, putative (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Phum_PHUM284180
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Phum_PHUM284180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 540 aa AA seqDB search
MNKKKKKKKKNCTKRTLTHSATFARRTSGQLIRTQYVPLYGRLVGEEQLETIREPADIQA
MQARIPQHFRDPSSAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQTQGEDTSHKKERKIF
NEGYDDDNHDYIIKNGEKFLDRYEIDNLIGKGSFGQVVKAYDHEEQCQVAIKIIKNKKPF
LNQAQIEVKLLEMMNRADADNKYFIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRG
VSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQ
RIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGTNEVDQMNKIIEV
LGMPPKHILDQAHKARKYFDKLPSDGSYVLKRPKDGKKYRSPGTRRLHDILGVDSGGPGG
RRLGEPGHTVADYLKFKDLILRMLDFDPKTRVTPYYALQQNFFKRTSDEGTNTANKSGRV
STSPAVSGLVDNIRGSPSSSASLGSNRALSDSILQLQNSALTSGTTVGSCIGPQLMDCDY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaaaaaaaaaaaaaaaaaaaaattgcacgaaacgcacactcactcactca
gcaacttttgcacgtcgtacgagtggccaactcataaggacgcagtatgttcccctctac
ggaaggctggtcggagaggaacaactggaaacaattagagaaccagccgatatacaggcc
atgcaggctagaatacctcaacatttcagggatccctcttcggcacccctgagaaaatta
tcagtggatttaataaaaacgtataaacacattaacgaggtttattatgcgaaaaagaaa
agaagagcgcagcagacacaaggagaagatacctcccacaaaaaagagcgtaaaatattt
aacgaaggctacgatgatgataatcacgattacatcatcaaaaatggcgaaaaattttta
gatcgttacgaaatagataatctaataggaaaaggatctttcggacaggtcgtgaaggca
tacgatcacgaagaacagtgccaggtggcaattaaaataataaaaaataaaaaacctttt
ttaaatcaagctcaaatagaagttaaattattggaaatgatgaaccgcgcagatgcggat
aataaatatttcatagtgagattaaaaagacattttatgtggaggaatcacttgtgccta
gtattcgagttgttatcatataatttatacgatctgttgcggaatacgaattttcggggc
gtgtccctcaatttaacgcggaaattcgctcagcaattgtgtacggctctcctgttttta
tcaactcccgaactcaatatcatacactgtgatttaaaacctgaaaatatacttttgtgc
aacccgaaaagatcggctatcaaaattgttgattttggaagttcgtgtcagttgggacaa
aggatatatcaatatattcagtcgaggttttataggtctccggaggttttgttaggtata
ccttacgatttagctatagatatgtggagtttaggttgcattttagtcgagatgcacacg
ggggagccgttatttagcggaaccaacgaggtggatcaaatgaataagataatagaagtt
ttgggtatgccacccaaacacatattagatcaagctcataaagcaagaaaatatttcgat
aagctaccctcagacggaagctacgtattaaaacggccaaaagatggtaaaaaatacagg
agtcctggaacgaggagattgcacgatatattaggcgtcgacagcggaggacctggtgga
agaagattgggtgaacccggtcacacggtcgcggattatttaaaattcaaagacttaata
ttgagaatgttggactttgatccgaaaacgagagtcactccctattacgctcttcagcaa
aattttttcaaaaggactagtgacgaagggactaacaccgcgaataaaagcgggagagtg
agcacgagtcccgcagttagcggattagttgacaatatcagaggatctccttccagctca
gccagtctgggaagcaaccgagctctttctgattcgattttgcagctgcaaaactcggca
ctcacgtcggggacgacagttggaagctgcatcggtcctcagttaatggactgcgattat
tag

DBGET integrated database retrieval system