KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM284900Help
Entry
Phum_PHUM284900   CDS       T01223                                 

Definition
myst histone acetyltransferase, putative (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 456 aa AA seqDB search
MKDKFVMASDQNVRHKNIRDKMVVNEKIGASTESKPPDNEDSESLEEQPLDIGEHYLVRR
NDESWHPAEVIQSRYNDQENHYEYYVHYEGLNRRLDEWVSRDRIMSSRFDLNEQHWKNND
KSNKDITDGLDRKITRNQKRRHDEINHIQKTFAEMDPTTAALEKEHEAITKVKYIDKIQI
GKFEIDTWYFSPYPDDYGKQTKLWICEYCLKYMRLDKTFRYHMSECTARHPPGKEIYRQG
TLSIFEVDGSNHKIYCQNLCLLAKLFLDHKTLYFDVEPFLFYILCDSNKHGAHLVGYFSK
EKESPDGNNVACILTLPPYQRQGYGKLLIAFSYELSRQEGKVGSPEKPLSDLGKLSYRSY
WSWVLLNELRDYNRGCITIKNLSLKTSISQTDIISTLQSMNMVKYWKGQHVICVTPKVVE
EHIKSPHFKKPRLTVDPKAILWAPLKKSNAKTGGKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaagtttgttatggcaagtgatcaaaatgtccgacataaaaatataagagat
aaaatggtagtgaatgaaaaaatcggagcaagtacggagtcaaaaccgccggataatgaa
gattcagagtcgttggaagaacagcctttggatataggagaacattatttagtaagaaga
aatgatgaatcttggcatccggctgaagttatacaaagcagatataacgatcaagaaaat
cattatgagtattacgtacactacgaaggtttaaatagacgtttggacgaatgggtgtcc
agagatagaatcatgtcatcaaggttcgacctgaatgaacaacattggaaaaataatgat
aaaagtaacaaggatataactgatggtttagataggaaaataacaagaaatcaaaaaagg
agacacgatgagattaatcacattcaaaaaacatttgcagaaatggatccgactacggct
gcattagaaaaagaacatgaagctataactaaagttaaatatatagataaaattcaaata
ggaaaatttgaaattgacacatggtattttagcccttatccagatgattatggaaaacaa
acaaaactctggatttgtgaatattgtttgaagtacatgagactggataaaacatttaga
tatcacatgagtgaatgtacggctagacatccacctggtaaagaaatttataggcaggga
acattatcaatatttgaagttgatggttccaatcataaaatttattgccagaatctttgc
ctactagccaaattatttttagatcacaaaactttgtattttgacgttgagccttttcta
ttttacattctttgtgattctaataaacatggagcacatcttgtcggttatttttcaaag
gaaaaagaatctccagatggcaacaatgtagcttgcatattaacattacccccttaccaa
aggcagggctatggtaaattattaatagcctttagttatgaactttccagacaagaagga
aaagtgggaagtccagagaaaccgctttcagatttaggaaaacttagttatagatcttat
tggtcttgggttcttttaaacgaactcagggattacaatagaggttgtataacgataaaa
aatttaagtttaaaaacgtcaatatcacaaacggatattatttcaacgcttcaatcaatg
aacatggtcaaatattggaagggacaacacgtgatttgcgtgacgccgaaagtcgttgaa
gaacatataaaatcaccgcattttaaaaaacctcgtctcaccgtcgatccgaaagcaatt
ttgtgggctccattgaaaaaatcaaatgccaaaactggagggaaaaaataa

DBGET integrated database retrieval system