KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM287330Help
Entry
Phum_PHUM287330   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:phu04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 751 aa AA seqDB search
MMMTMLDNGPHRELPVDVPDSFIAISKTPPRYPPPRTQGSSRMNGLAKPIPPPRDHLTIE
KDGRLMNRLPAPQVPARTVMTINNNTQREPTKREMDSIRKFEEQIRQRKEEEERIAKQNE
FLKSSIRSSKKLQAVESNPPLTGVINDAYSDEEGKDDVAATDIVHKFILYGELVAALQRL
QHQIKENNAPCLGNLEPQLATVQAILLSPQFGRALSVCNKVREVTLSNEKQCLPSPQSWQ
AQELARDCIQILEPCSLPEAGELNQILTSYGMEGLLSAHDTIASGDIVALDAPATDVLLT
SEDAHYISKESTGIKIVNIDKTNEPLGATVRNEGEAVIIGRIVKGGAADKSGLLHEGDEV
LQVNGVDMRGKTIHDVCDILSGMIGTLTFLIIPGHTPRPIQPTNTNTVMHMKAHFDYDPE
DDTYIPCKELGISFQKGDVLHVISQEDPNWWQAYREGEEDQVLAGLIPSRTFQHQRESLK
QQIAGDKLSKEKTKKSSTLLCAKKHNKKKRKKSSCNAYNEGSYPIYSSTLDDYDADEILT
YEEVSLYYPRSNHKRPIVLIGPPNIGRHELRQRLMEDSERFAAAIPHTSRARKESEVDGQ
DYHFTSRAQFESDILARKFVEHGEYEKAYYGTSLDAIRTVVSSGKICVLNLHPQSLKILR
SSDLKPYVVFVAPPSLEKLRQKKIRNGEAYKEDELKGIIEKAREMEDKYGHFFDMIIINN
DTERTYLQLLKEINSLEREPQWVPASWVKAV
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacaatgctagacaatggtccacatagagagcttcccgtggatgtacccgat
tcttttattgccattagcaaaacaccaccaagatatccaccgccaagaactcagggttca
tcacgcatgaacggtttggctaaacctattcctccaccgagagatcatttaacaattgaa
aaagatgggagactgatgaataggttaccagctccgcaggttccagcgagaactgttatg
actatcaataacaatactcaaagggaaccaaccaagcgggaaatggatagtattagaaaa
ttcgaggaacaaattaggcaaagaaaagaagaagaggaaaggatagcaaaacaaaatgaa
tttcttaaaagttcaataagaagttcgaaaaagcttcaagctgttgaaagtaatcctcct
ctaaccggagttattaacgatgcctattcagacgaggaaggaaaagatgatgttgctgcg
actgatattgttcataaatttatactgtacggagaattagtcgccgctttgcaaagactt
caacatcaaataaaagaaaataatgcgccttgtttgggaaaccttgagcctcagttggca
acagtacaagcaattttgttaagtccacaatttggacgagctctttccgtttgtaataaa
gtccgagaagtaactttgtcaaacgaaaaacaatgtttacctagtccgcagtcttggcaa
gctcaagaattggctagagattgcattcaaattctcgaaccgtgctctttaccagaagct
ggcgaattaaatcaaatattaactagttatggtatggaaggattattatctgctcacgat
acaattgcctcgggtgatattgttgccttggatgctcctgccacagatgtacttttaaca
tctgaagatgctcattacatttctaaagaatctacgggcattaaaattgttaatattgac
aaaacgaatgagccactcggtgcgactgttagaaacgaaggagaagctgtaattattggt
agaatagttaaaggaggagcagctgataaatccggtctcttacacgaaggagacgaagtt
ttacaagtaaacggagtagatatgagagggaaaactatacatgatgtctgtgatatattg
tctggaatgataggaactttgacttttctcatcattcccggacacacacctaggcccatt
cagcctacaaacacgaacactgtcatgcacatgaaagctcattttgattacgatccggaa
gatgatacttacataccgtgcaaagaattaggtatcagttttcaaaagggagatgttctt
catgttatttctcaagaagatcccaattggtggcaggcgtatagggaaggagaagaagat
caagtattagcaggattgatacccagtagaacttttcaacatcagagagagtctctcaag
caacaaatagctggagacaaattatcaaaggaaaaaaccaaaaaatcatcaacattatta
tgtgccaaaaaacacaataaaaagaaaaggaaaaaatcgtcatgcaatgcttacaatgaa
ggaagttatccaatttattccagtactttagacgattacgacgcggatgaaatattaaca
tacgaagaagtgtctctatattaccccagatcaaatcacaaacgcccaatagtattaata
ggacctccaaacataggaagacacgaattaaggcagaggttaatggaagattccgaaaga
tttgctgctgctattcctcatacgtcgagagcaagaaaagaatcagaagttgacggtcaa
gattatcattttacatctcgagcacaatttgagtctgatatattagctagaaaattcgtg
gaacatggagaatacgaaaaagcttattacggtacatcgttagacgctataagaactgtt
gtgagttctggtaaaatctgcgtattaaatctacatcctcaaagtttaaaaatattaagg
agttcggatttgaaaccttatgtcgtttttgtcgcgccgccatctctcgaaaaactaagg
cagaagaaaataaggaatggcgaagcgtataaagaggatgaattgaaaggtataattgaa
aaagcaagagaaatggaagataaatacggacattttttcgacatgataataataaataac
gatacggaaagaacgtacttacagttattaaaagaaataaatagtttagaacgtgagcca
caatgggtaccagcatcctgggtcaaggctgtttga

DBGET integrated database retrieval system