KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM299230Help
Entry
Phum_PHUM299230   CDS       T01223                                 

Definition
Arginase, hepatic, putative (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Phum_PHUM299230
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Phum_PHUM299230
Enzymes [BR:phu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Phum_PHUM299230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MLCKVINGVFLHETKYLSQKWFSSKSFYPQNLNGKLSIIGVPFGKGQKKQGKTEDGLKMA
PDCLRQTGFIDILKDLGMDVEDLGNITYEPEVGLQHENMTNLDHFAPCALQVSNCVSSAL
QDCRACLMMGGDHSLATGSIHGHISVAGPQNVGVIYIDAHADINTASSSLSGNIHGMTVA
MLAEELRKFWPNSQVPGLEWLTPCLPLGNIAFIGLRSVDPEETVFLDENNVAAYTMEDVE
NYGLHKVLCEAIKRVDPNGNKSIHLSFDIDSLDPLEAPCTTVPVRGGLTLREGIKIGETL
CRTKRLSVVDFVEVNPPLGSEIQRQTTLDAAFHVLLSVFGYSRRGNPR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctatgtaaagttataaatggagtttttttacatgaaacaaaatatttaagtcaaaaa
tggttttcaagcaaatcgttttacccacaaaatttaaatggaaaactaagcattatcgga
gttcccttcggtaaaggtcaaaagaaacaaggaaaaacagaagatggattgaaaatggca
cctgactgtctacgacaaactggttttatcgatatattaaaagacctgggtatggacgtt
gaagacctaggtaatataacgtatgaaccggaagtcggccttcaacatgagaatatgaca
aatcttgatcattttgctccttgtgctctgcaggtatctaattgcgtatcgagtgcttta
caagactgcagagcgtgtttaatgatgggaggagatcattctctggctaccggttcaata
catggacatataagcgttgccggaccgcaaaatgttggtgtcatatatattgacgctcac
gccgatataaatacggcttcaagtagcttaagtggaaatatacatggtatgacagtggca
atgctagccgaagaattacgaaagttttggccaaattctcaagttcccggtcttgaatgg
ttaaccccgtgtttgccattaggtaatatcgccttcatcggattgaggtctgtagatccg
gaggaaacggtatttttggacgaaaataatgtcgcggcttacacaatggaagatgttgaa
aattatggattacataaagtattgtgcgaagcaataaaaagagtagacccaaatggaaat
aaatcaattcatctgagtttcgatatagattcgttagatccccttgaggctccctgtacg
accgtgccagtacgaggtggtttaacgcttagagaagggattaaaattggagaaacttta
tgcaggacgaaaaggttatctgtcgttgatttcgtagaggtaaatcctcctctaggtagt
gaaattcaacgacagacaacattggatgcagcctttcatgttcttttgtcagtgtttgga
tattccagacgtggaaatccaagatga

DBGET integrated database retrieval system