KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM308460Help
Entry
Phum_PHUM308460   CDS       T01223                                 

Definition
glutathione peroxidase 6 precursor, putative (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Phum_PHUM308460
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Phum_PHUM308460
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Phum_PHUM308460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 131 aa AA seqDB search
MKCLTVMVRLILLKFFQQEPGGNATEILNGIRFVRPGNDFIPSFQLCQKSDINGKNELPM
FTYLKAYCPTTRDGFEDTTVLFWKPLKNNDVKWNWEKFLITRKGMPYMRYDPSTEPDAIR
PDIEFLLQNDI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcctaacggtcatggtccgattaatattgttgaaatttttccagcaagaacct
ggtgggaatgccacagaaatattaaacggaatcagatttgtacgtcctggaaatgatttt
ataccaagttttcagttatgtcaaaaatctgatatcaatggtaaaaatgagcttcccatg
tttacatatctaaaggcctattgtccgacgacaagagacggttttgaagatacaacggta
ttattttggaagccattaaaaaacaacgatgttaaatggaattgggaaaaatttttaata
acaagaaagggaatgccatatatgagatacgatccgagcacagaaccggatgcaatacgt
ccggatattgaatttcttttacaaaatgatatttaa

DBGET integrated database retrieval system