KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM308460Help
Entry
Phum_PHUM308460   CDS       T01223                                 

Definition
(RefSeq) glutathione peroxidase 6 precursor, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00480  Glutathione metabolism
phu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Phum_PHUM308460
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Phum_PHUM308460
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Phum_PHUM308460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 8235787
NCBI-ProteinID: XP_002427285
VectorBase: PHUM308460
UniProt: E0VME1
AA seq 131 aa AA seqDB search
MKCLTVMVRLILLKFFQQEPGGNATEILNGIRFVRPGNDFIPSFQLCQKSDINGKNELPM
FTYLKAYCPTTRDGFEDTTVLFWKPLKNNDVKWNWEKFLITRKGMPYMRYDPSTEPDAIR
PDIEFLLQNDI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcctaacggtcatggtccgattaatattgttgaaatttttccagcaagaacct
ggtgggaatgccacagaaatattaaacggaatcagatttgtacgtcctggaaatgatttt
ataccaagttttcagttatgtcaaaaatctgatatcaatggtaaaaatgagcttcccatg
tttacatatctaaaggcctattgtccgacgacaagagacggttttgaagatacaacggta
ttattttggaagccattaaaaaacaacgatgttaaatggaattgggaaaaatttttaata
acaagaaagggaatgccatatatgagatacgatccgagcacagaaccggatgcaatacgt
ccggatattgaatttcttttacaaaatgatatttaa

DBGET integrated database retrieval system