KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM313730Help
Entry
Phum_PHUM313730   CDS       T01223                                 

Definition
UDP-glucuronosyltransferase 1-8 precursor, putative (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phum_PHUM313730
   00053 Ascorbate and aldarate metabolism
    Phum_PHUM313730
   00500 Starch and sucrose metabolism
    Phum_PHUM313730
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Phum_PHUM313730
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM313730
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Phum_PHUM313730
   00982 Drug metabolism - cytochrome P450
    Phum_PHUM313730
   00983 Drug metabolism - other enzymes
    Phum_PHUM313730
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Phum_PHUM313730
Glycosyltransferases [BR:phu01003]
 Others
  Hydrophobic molecule
   Phum_PHUM313730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 522 aa AA seqDB search
MIFLIFFGIFFISNSCFGANILYLVPLPAKSHYILGEKLVKELAGRGHEITIISSFKMSN
PPKNIKEIIMPASLEDFGLFNKGKESGTFQLRKMSPIDFILFSAVGNMMTNKTLSDPNVR
NLLKSNKKFDLIIGECFLTEGLLGGFSYKYKAPMIGVATFIPNTWSNEMVGNPASSAYVP
EPILPYTNEMTFYERCMNFFYGMLSQYAYYNRHIPAQDKIMKSFFGQNVPDLRELIRNTS
LVLVNHHHSMSFPRPYLPNMIEIGGYHVNPPKPLPKDLQKYMDESKDGVILFSMGSNLKS
SDLPESRLVEILTAFSKLKQRVIWKFEKEDLPNIPENVLISKWLPQSDILAHPKVKLFVT
HGGGLSLTEAVDRGVPVVAIPIFGDQPLNVKFVEKFKIGVGLEYEEISGKKLLESINEVL
NNPMYDSNVKQKSKILKDNPMTQLETAMYWIEYVIRHDGAPHLRSATQNLTWYQIYLLDV
FAFLAVVVLTFFFIVYKLLKCLKNCLCRGKKEKNVSSLKKNK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgatttttttaattttttttggaatttttttcatttcgaattcttgtttcggtgcaaac
atattatatctagtaccactgcctgctaagagtcactacatactgggagaaaaattggta
aaagaattggcggggagaggacacgaaataacaataatatcatcatttaaaatgtcaaat
ccgccgaaaaacatcaaagaaataataatgccggcttcactcgaagatttcggattgttt
aataaaggaaaagaatcgggaacgtttcaattgagaaaaatgtctccgatcgattttatt
ttattcagcgcagttggtaacatgatgacgaacaaaacattgtcggatcccaacgttcgg
aatttattaaaatcgaataaaaaattcgatttgattatcggagaatgttttctgacggaa
ggtttgttgggtggattctcatataagtacaaagcacccatgatcggagtcgctacattt
ataccaaacacgtggtcgaacgaaatggtaggaaatccagcgtcgtctgcttacgttcca
gaacctatattaccatatacaaacgaaatgacgttctacgaaagatgtatgaattttttt
tacggtatgttatcgcaatacgcttactacaaccgacacataccagcacaggataagata
atgaaaagttttttcgggcaaaacgtacctgatttaagagaattgataaggaatacgtcg
ctggtattggtcaatcatcatcacagcatgtcttttccaaggccgtatcttccaaacatg
atcgaaatcggtggttatcacgtaaatccaccaaaacctcttccgaaagatcttcaaaaa
tatatggacgagtccaaagatggcgtcattttattttccatgggttcgaatttaaaaagt
tcagatttaccggaaagcaggctcgtggaaatattgacagcgttttcgaaattaaaacaa
agagtcatatggaaatttgaaaaagaagatttaccaaacatacctgaaaatgttttaatt
tcaaaatggcttccgcaaagtgatatattagctcatccgaaggtgaaattattcgtgaca
cacggaggaggtctcagtttaacggaagccgttgatagaggagttccggttgtcgccata
ccgattttcggggatcaaccacttaatgttaaatttgttgaaaaatttaaaatcggtgtc
ggtctcgaatacgaagaaatctctggaaaaaaattactggagtctataaacgaagtatta
aataatccgatgtacgattcgaacgttaaacaaaaatcaaaaatccttaaggataatcct
atgacgcaattggaaacggcaatgtattggatcgaatacgtcataagacacgatggggct
ccacatttacgttcggcaacgcaaaatttaacgtggtatcagatttacttgctcgacgtt
ttcgcatttctcgccgtcgtggttttaacatttttcttcatcgtttacaaattgttaaaa
tgtctcaaaaattgtttgtgtcgtggaaaaaaggaaaaaaatgtttcgagtttgaaaaaa
aataaatga

DBGET integrated database retrieval system