KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM315980Help
Entry
Phum_PHUM315980   CDS       T01223                                 

Definition
histone-lysine N-methyltransferase, H4 lysine-20 specific, putative (EC:2.1.1.43)
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:phu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 251 aa AA seqDB search
MHRNLMDKVIGINSPIEKSSNDIKYSSNELTEKKENSLKAINNTDQCLKYTPEKNKSQSR
NCNTLSEKFPKNNLSRNHKVTEYFPVRRSVRKTKKTVLEEKQKNLEECVLSKREDGLKVV
HFEGKGRGVVTTKKFYKGEFVVEYSGELIDMIEAKVRENNYAKDQNTGCYMYYFKYKNIK
YCVDATAESGRLGRLVNHSRNGNLSTKIISINSTPHLILVAKEDIEFGEEVCYDYGDRSK
ESLKYHPWLAS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaatttgatggataaagtgataggaatcaattctcccatagaaaaaagttcc
aatgacattaaatattcttctaatgaactgacggaaaaaaaagaaaattctttaaaagct
attaataatactgatcagtgtttaaaatatacaccagaaaaaaataagtcacaatctaga
aattgcaatactctcagtgagaaatttcctaaaaataatcttagtcgaaatcataaagtc
actgaatattttcccgttagaagaagtgtgagaaaaacaaaaaagactgtactagaagaa
aaacaaaaaaatttagaagaatgtgttttatctaaaagagaagatggactgaaggttgtt
cactttgagggtaaaggaagaggtgtagttactacaaaaaaattttataaaggagaattt
gtcgtcgaatactctggtgaattgattgatatgatagaagctaaagttagagaaaacaat
tatgcaaaagatcaaaatacaggatgttatatgtattattttaaatacaaaaacattaaa
tactgtgttgatgcgactgcagaatcaggacgattaggaaggcttgttaatcattctaga
aatggaaatttatcgactaaaataatatcaataaattccactcctcatttaatattagta
gcaaaagaagatatagaatttggtgaagaagtttgttacgattatggggatcgaagtaaa
gaaagtttaaaatatcatccatggttagcttcttga

DBGET integrated database retrieval system