KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM315980Help
Entry
Phum_PHUM315980   CDS       T01223                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H4 lysine-20 specific, putative
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM315980
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Phum_PHUM315980
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Phum_PHUM315980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF4116 LMBR1
Motif
Other DBs
NCBI-GeneID: 8235931
NCBI-ProteinID: XP_002427372
VectorBase: PHUM315980
UniProt: E0VMM8
AA seq 251 aa AA seqDB search
MHRNLMDKVIGINSPIEKSSNDIKYSSNELTEKKENSLKAINNTDQCLKYTPEKNKSQSR
NCNTLSEKFPKNNLSRNHKVTEYFPVRRSVRKTKKTVLEEKQKNLEECVLSKREDGLKVV
HFEGKGRGVVTTKKFYKGEFVVEYSGELIDMIEAKVRENNYAKDQNTGCYMYYFKYKNIK
YCVDATAESGRLGRLVNHSRNGNLSTKIISINSTPHLILVAKEDIEFGEEVCYDYGDRSK
ESLKYHPWLAS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaatttgatggataaagtgataggaatcaattctcccatagaaaaaagttcc
aatgacattaaatattcttctaatgaactgacggaaaaaaaagaaaattctttaaaagct
attaataatactgatcagtgtttaaaatatacaccagaaaaaaataagtcacaatctaga
aattgcaatactctcagtgagaaatttcctaaaaataatcttagtcgaaatcataaagtc
actgaatattttcccgttagaagaagtgtgagaaaaacaaaaaagactgtactagaagaa
aaacaaaaaaatttagaagaatgtgttttatctaaaagagaagatggactgaaggttgtt
cactttgagggtaaaggaagaggtgtagttactacaaaaaaattttataaaggagaattt
gtcgtcgaatactctggtgaattgattgatatgatagaagctaaagttagagaaaacaat
tatgcaaaagatcaaaatacaggatgttatatgtattattttaaatacaaaaacattaaa
tactgtgttgatgcgactgcagaatcaggacgattaggaaggcttgttaatcattctaga
aatggaaatttatcgactaaaataatatcaataaattccactcctcatttaatattagta
gcaaaagaagatatagaatttggtgaagaagtttgttacgattatggggatcgaagtaaa
gaaagtttaaaatatcatccatggttagcttcttga

DBGET integrated database retrieval system