KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM318270Help
Entry
Phum_PHUM318270   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04140  Autophagy - animal
phu04213  Longevity regulating pathway - multiple species
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
Module
phu_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM318270
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM318270
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Phum_PHUM318270
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM318270
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM318270
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  PKA family
   Phum_PHUM318270
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Phum_PHUM318270
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Phum_PHUM318270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 8236051
NCBI-ProteinID: XP_002427414
VectorBase: PHUM318270
UniProt: E0VMS0
AA seq 385 aa AA seqDB search
MLRYKSNNSGYANRCAFLLEKLSDNVEKKDVTKMGNAPTSNKKCDPVESVKEFLDQAKED
FEEKWKNVSSNTAELDDFERIKTLGTGSFGRVMIVQHKNLKEYFAMKILDKQKVVKLKQV
EHTLNEKRILQAINFPFLVSLKYHFKDNSNLYMVLDYVPGGEMFSHLRKVGRFSEPHSRF
YAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYL
APEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDL
KDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFASTDWIAVFQKKIEAPFIPRCKGAGDTS
NFDDYEEEALRISSTEKCAKEFAEF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggtataagagtaataattccggctatgctaacaggtgtgcctttttacttgaa
aaattgtcagataacgttgaaaagaaagacgttacaaaaatgggaaatgcccccacttcg
aataaaaagtgcgatcccgttgaaagtgttaaagaatttctcgatcaagccaaggaagat
ttcgaagaaaagtggaaaaatgtatcatccaatacagctgaattggatgattttgaaaga
atcaaaactcttggaaccggttccttcggtagagttatgatcgttcaacataaaaactta
aaagaatactttgctatgaaaatattagacaaacaaaaagtagttaaattaaaacaagta
gaacatactcttaacgaaaagcgtatcttgcaagctatcaattttccatttttagtaagc
ttaaaatatcatttcaaagacaattcgaatctttacatggttttagattacgtacccggt
ggagaaatgttttcacatcttcgaaaagtaggaagattcagcgaacctcattcgaggttt
tacgctgcacaaatagtgcttgcctttgaatatcttcattacttagatctcatttacaga
gacctcaaaccggaaaatctgttaattgattcacaaggatatcttaaagttacggatttc
ggatttgccaaaagagtcaaaggaagaacatggaccctgtgcggtacaccagaatatctg
gcacctgaaataatattgagcaaaggatataacaaagcagtcgattggtgggcactcgga
gttctcgtctacgaaatggctgctggttatcctccattttttgctgatcaaccaatacaa
atatatgagaaaatagtatctggtaaagtgagatttccatcacactttggctcagattta
aaagatctactgagaaatttactccaagttgatctaactaaaagatatggaaatttaaaa
aatggagtgaatgatataaaaggtcataaatggtttgcatcgacggattggatagctgtt
ttccagaagaaaatagaagcgccattcatacctagatgcaagggtgcaggcgacacaagt
aattttgatgattacgaagaagaagcattgagaatatcatcaacagaaaaatgtgctaaa
gaatttgccgagttttaa

DBGET integrated database retrieval system