KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM335510Help
Entry
Phum_PHUM335510   CDS       T01223                                 

Definition
Phosphoglycerate mutase, putative (EC:5.4.2.4 3.1.3.13)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:phu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:phu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:phu00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:phu00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 254 aa AA seqDB search
MGKYDIYMVRHGESEWNDKNLFCGWYDAVLSEKGYEEAVNAGKYLKEANVKFDCAHTSVL
TRAKKTLEAILVVTEQLDIPVYETWRLNERHYGALTGLNKSETAIKYGETQVQIWRRSFD
VPPPAMGEDHLYYNEIVNDPRYAKGPSREEFPLGESLKKTMERTMPYWNKTILPQIKEGK
RILIVAHGNSLRGIIKGLMKLSDEEIMLLNLPTGVPFMYTLNENLEPIAPMKFLGDEETV
KKAIEAVVNQGKAK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatatgatatttatatggttcgtcacggtgaaagtgaatggaatgataaaaat
ttattttgcggatggtatgacgcagttttaagcgagaaagggtatgaagaagcagtaaac
gctggaaaatatcttaaagaagcaaatgtaaaatttgattgtgctcatacttcagttttg
accagagccaagaaaacattagaagctatattagttgtaactgaacagcttgatattcca
gtttatgaaacatggaggttaaatgaaagacattatggagcattaactggtttaaataaa
tcggaaactgctataaaatacggagagactcaggtacaaatatggagaaggagttttgat
gtacctcctccagcgatgggtgaagatcatctttattacaatgaaatagtaaatgatccg
agatatgcaaaaggtcccagtagagaagaatttccattaggagaatcattaaagaaaaca
atggagagaacaatgccttattggaacaaaacaatattgcctcaaataaaagagggtaaa
agaattttgattgtcgctcatggaaatagcttaagaggaataataaaaggtttaatgaaa
ttatcggatgaagaaataatgttgttaaatttgcctactggagttcctttcatgtataca
ttaaatgaaaatttagaacccattgcaccaatgaaatttttaggcgatgaagaaactgtg
aaaaaagcaatcgaagctgtcgttaatcagggaaaagccaaatag

DBGET integrated database retrieval system