KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM336820Help
Entry
Phum_PHUM336820   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Phum_PHUM336820
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Phum_PHUM336820
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Phum_PHUM336820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1543 aa AA seqDB search
MSSEKFLNPVETKILPIIGNFPKEKEENQFLTKVIVLNNQQYLDSTLNYLEKGWTLEFHI
GSSLFGKEIKLFTNYPKPDTDFNRNNYQELEWGKSHKNECKNDFSRENALTSSLFLSRAG
SFHYYFNDSLRNETIGSGYFIVNPILAFSNNDILPLNSIAVQTVLAKSLGKFENWKNVLK
VSKESGYNMVHFTPIQELGGSNSSYCIKDQLNLNPAFNSDNCCPNYEDVMKLTSEMRKEW
RILSISDVVLNHTANETPWLQVHPECTYNAITAPYLIPAAILDGHLHVLTKEISSGKHEE
IGIPSEIYTHDHLEAVKNYLTKNLIPQLRLHEFYTADVTKLSDEFLEKAKAQIPTLETCS
RTELKLINNFNGRNKATVNLDLALKIFNIIRNDTTDEETRLAENVNDFKKRILDLNSEIK
NEIGIHLSSAIENCIANMRYFRIQEDGPKIKSVSEENPLVPRYFTGKFENYDSVENEVLK
NGQYVMAHNGWVMNSDPLKNFAESDSNVYLRRELIAWGDSVKLRYGKSYQDCPFLWNHME
KYVEKTAEIFDGIRLDNCHSTPLHVAEYLLDCARKINPDLYVVAELFTNSDVTDNIFANR
LGITSMIRESLNAYDSFELGRLIHRFGGKPVGSFHERKKSTLLPSVSHALFYDVTHDNPS
LISKRSVFDSLSTSALVSMACCGIGSTRGFDELVPHHINVVSEKRLYPSWSDDSATNTSS
VNLSTGFISVRKALNKIHGELSENGFDQVFVDQMNDDVIAVTRHNPITHESIILVSYTAF
HHDNPTRAVKNLKIEGELIEIILEAKILREDDDSATEFKPNDEYINGLSNYHVLMDQNLK
IPESKMIKLVENDFKICEIEFENYVPGSIIVFRVSPREDIRPLLQGLDEKIKSFINFEFD
SEIFSAVSKLNLIDLNHALYRCTEEDLEDGTGSYFIPGYGQLVYCGLQGFESVLREVVMK
NDLGHPLCNNLRQGDWMLDYVIGRLKTCKATVELALILEKIFENVRQIPKYLVPSYFELI
VTSICYLLKSRAAYQMSEFVKNGSTFIRFLALGSVQCVGVVDSSSLPPFSANMVASDDGK
RKITMSAGLPHFSTGYMRSWGRDTFISLRGLLLLTGRFEDAKYHILGYASCLRHGLIPNL
LDQGVNARYNCRDAVWWWLHSIISYIDLVPDGHEILKEMVSRIFPNDDSPPLGPGLVNQP
LFDIMQEALNVHFKKLSFRERNAGPGIDAHMTDEGFNNEIGIDTNTGFVYGGNEFNCGTW
MDKMGSDSKTGNRGKPATPRNGSAVELVGLCKAVVTRLHSLNEKGIYPYSGVEKLNGKGE
VEKWSFKDWERKILENFEKMFWIPEKISQTETKPELIHRRQIYKDSVGASPPWSDYQLRP
NFLIALTVAPEMVDPKNAWAAIKKVENILLGPLGIKTLDPADWNYNGFYNNDDHSDNIKT
AQGFNYHQGPEWLWPVGYFLRAKIYFSRQFGREECLKSISEVKTYLGNHYQEICESHWRG
LPELTNADGQYCQNSCRVQAWSMACILEVLHDIYLIEKEYEKK
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgaaaagtttttgaatccagttgaaacaaaaattttacccattattggaaat
ttccctaaagaaaaggaggaaaatcaatttctgactaaagtaattgttttaaataatcaa
cagtatcttgattctactcttaattatttggaaaaaggatggactcttgaatttcacatt
ggatcttcattgtttggaaaagaaattaaattatttaccaattatccaaaaccagacaca
gactttaataggaataattatcaagaattagaatggggcaaaagtcataaaaatgaatgc
aaaaatgacttttctagagaaaatgctttaacatcttctctctttttatccagagcagga
tcctttcattattattttaacgacagtttgagaaatgaaactataggatctggatatttc
atagttaatccaatattggcattttcaaataatgatattttacctctcaattcgattgca
gttcaaacggttttggcaaaatctcttggaaaatttgaaaattggaaaaatgttcttaaa
gtcagtaaggaaagtggatacaacatggtacattttacaccaattcaggaacttggaggc
tccaattcgtcatattgcataaaagatcaattaaatttaaatcctgcattcaatagtgat
aactgctgtccaaattatgaagatgtcatgaaattaacatctgaaatgagaaaagaatgg
aggattctctctattagtgatgtagtactcaatcatacagcaaatgaaactccttggtta
caagttcatccagaatgtacctacaatgcaattacagcaccatatttaattcctgcagct
attttagatggtcatcttcatgttttgacaaaagaaatttcctctggtaaacatgaagag
attggaatcccttcagaaatttatactcatgatcacttggaggctgtgaaaaattattta
acaaaaaatttaataccacaacttcgtctacatgaattttataccgccgatgtgacaaaa
ttgtcagatgaatttttagaaaaagcaaaggctcaaatacctacgttagaaacctgtagc
agaaccgaattaaaattaataaacaattttaatggaaggaataaagcaacagttaattta
gatcttgctcttaaaatttttaatataattagaaatgatactactgacgaagaaacaaga
ttagccgaaaacgttaatgattttaaaaagagaatactcgatttaaattccgaaataaaa
aatgaaataggaattcatttatcatctgctatagaaaattgcattgccaatatgagatat
tttagaattcaggaagatggtccaaaaataaaatcagtatctgaagaaaatccacttgtg
cccagatattttactggtaaatttgaaaattatgattctgtagaaaatgaagttttaaaa
aatggacaatatgttatggcacataatggatgggtcatgaattcagatcctcttaaaaat
tttgccgagtctgattcgaatgtttatttaagaagggagttgattgcttggggagacagc
gttaaattaagatatggaaaatcttatcaagattgtccttttttatggaatcacatggaa
aaatatgtggaaaaaactgcggaaatatttgatggaattcgactcgataattgtcattct
acgcctcttcatgtagctgaatatcttttagactgtgctaggaaaataaatccggattta
tatgtggttgccgaactatttacaaattcagacgtgactgataatatttttgctaacaga
ttgggtattacctcaatgataagagagtcattaaatgcttatgacagtttcgaattggga
agactgattcacaggttcggtggaaaacccgtcggtagttttcacgaaaggaaaaaaagt
actttgctccccagcgtttctcatgctctattttatgatgtaactcacgataatccaagt
ctcattagcaaaagatcagtttttgattctttatcaacttctgcattagtttctatggct
tgttgtggaatcggtagcacaagaggtttcgatgaattggtaccacatcacattaatgtc
gttagtgaaaaaagattatatccttcttggtcggatgattccgctacaaatacctcctcg
gttaatttaagcacgggatttatttccgttagaaaagctcttaataaaattcacggagag
ttaagtgaaaatgggtttgatcaggtgtttgtcgatcaaatgaacgatgatgtgattgcc
gtaacgagacacaatccgatcacacacgaaagtataattttggtgtcttacactgcattt
catcacgataatccaacgagggcagttaaaaatttaaaaatagaaggagaattaattgaa
attattttagaagccaaaatcttacgtgaagatgatgattctgcgacagaatttaaaccg
aatgatgaatatattaacggtttgtcaaactaccacgtgcttatggatcaaaatttaaaa
atacctgaaagtaaaatgataaaattagttgaaaacgattttaaaatttgtgaaatcgaa
tttgaaaattacgtacctggttccattattgttttccgcgtttcaccccgtgaagacatt
cgtccccttttacaagggctcgatgaaaaaataaaatcatttattaattttgaattcgat
tcggaaatattttctgccgtatcgaaattaaatttaattgatttgaatcacgctttgtat
agatgcacagaagaagatttagaagatggtacgggttcgtatttcatacctggatatggt
caacttgtttattgcggacttcaaggttttgaatccgttcttcgagaagttgttatgaaa
aatgatttgggtcatccattatgtaataatttaagacagggcgattggatgttggattac
gttattggacgtttgaagacttgcaaagctaccgtggaattagctctcattttagaaaaa
atattcgaaaatgtacgtcagattccaaaatatttagtacccagttatttcgaattaata
gtgacgtcaatttgctatttgctcaagtcgagagctgcgtatcaaatgagcgaatttgtt
aaaaacggttcgacttttatacgttttcttgcattgggttctgttcagtgcgtcggcgtc
gttgattcttcttctttaccgccattttctgcaaacatggtcgcgtccgatgacggaaag
agaaaaataacgatgagtgctggtttacctcatttttcaaccggatatatgaggtcgtgg
gggcgagatacatttatatctttaagaggattattgttattaactggaagattcgaagat
gcaaagtatcatattctcggatacgcctcgtgccttcgtcacggtcttataccaaacctt
ttggatcaaggagtgaacgctaggtataattgtagagatgccgtttggtggtggttgcat
tctatcatttcgtacattgatttggtacctgacggacacgagattttgaaagaaatggta
tcgagaatttttccaaacgatgacagtccacctttgggtcctggactcgtgaatcagcca
ttgtttgatataatgcaagaagctctcaacgtgcattttaaaaaattatccttcagagaa
agaaatgcagggccaggtatcgacgctcacatgaccgacgaaggttttaataatgaaatc
gggattgatacgaacacgggtttcgtgtacggtggaaatgaatttaattgcggtacttgg
atggataaaatgggttcggattcgaaaacgggaaacaggggaaaacccgcaacgccgcga
aatggttccgccgtagaattggtaggattgtgtaaggctgtcgtcactcgattgcactcg
ttaaacgaaaaaggaatttatccctattcgggagtcgaaaaacttaacggaaaaggtgaa
gtagagaaatggtcgttcaaagattgggaaaggaaaattttggaaaattttgaaaaaatg
ttttggatacctgaaaaaatttcacagacggaaacgaaaccggaattaattcatcgaagg
caaatttataaggatagcgttggagcatcgccaccctggtcagattatcagttgagacct
aattttctcattgctttgacagtggcacctgaaatggtcgatccgaaaaatgcttgggcc
gccattaaaaaagttgaaaatattcttctaggtcctctaggtataaaaacattagatccg
gcggattggaattataacggattttacaacaacgacgatcattcggataatataaaaaca
gctcaaggttttaattatcatcaaggaccggaatggttgtggccggtcgggtatttttta
agagctaaaatttatttttctcgacagtttggcagggaagaatgtttgaaatcgatttcc
gaagtcaagacgtatttgggaaatcattatcaggaaatatgcgaatctcattggcgagga
cttccggaattaacaaacgcagatggacaatattgtcaaaatagttgcagggtacaagcg
tggagcatggcttgcattttagaagtattacacgatatatacctgatcgaaaaggaatat
gaaaaaaaataa

DBGET integrated database retrieval system