KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM349830Help
Entry
Phum_PHUM349830   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Phum_PHUM349830
Peptidases [BR:phu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Phum_PHUM349830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1009 aa AA seqDB search
MSRLQFLDLTDATENDQSFIERVLFSNNQVLEVPWNTRHAKESEVEVEQEWTNVSYTNEF
ERDQDLQTHNQVQEPLSDNEQCREEVQNEGNHQEHSDQIPQQEHVPRQGGIFPGHPPTSM
PHQPQMYQMLPSLSNVYVSNVTANVNVHAPYVQPIPAPYGHQVPPQQQQPPQQMFSHGPP
EGSDQGNRSRRQRQKAEKKREGPFVQSNEVISPSLDGHPPPQFPNIPPMPPYYLPGAPGA
PVYMQHAILPVYPSPLFTPYSHTPGPMVYPQTNNIEHGSEDYNGNVQQSFSQENSEMIVV
GCEIRSENSSDQRRGVEENGNNYNIEELSEQAIPEVTGFKSGSENSQFHEESADGQLDQT
FVSQQNSGSYDNSSKRDLSGNIFEKKEKEVESDVDNVKQITFGDQTAHLISTSNEDPNNL
PPDVLNKSTTSKKKTNGELDVNNVDKVSVNSNSSATAWANDGHSSVLHSGTNNVKLFSSA
SAQVVKAQESLVPASQQSSEFPLIRQGTKSTRFALAAVEPEPASNQINSSSGGKSWASLF
NKQEQLNSNSGSDVKGRPLARVLPYEVDTPSTGLSSAGPSSTIVPSASVKVSKLGGVTSN
GPLTQETVTSSDLYELEHKIISLQPRGLTNRSNWCYVNAVLQSLIACPPFYNLLKALPVT
PNKKGNKQTLIVDALVEYANEFSPIPANARIGKREKSARNKDENNIVEIVTGPAFEPSGI
YKILDKVRGGSSFNVEGRQEDAEEFLSCLLNGLNDEMFELMKMVGINRLDLANGDAHDSL
GGNIDDDDSEWNVMGPKNKSSITRRAVCGKTPVSDIFRGQFRSRVQRAGEQSTDTVQPFF
TLQLDIEKANSVKDALELFMGKDPLEGVTCSKTHQEVEAWTQTTLEDLPLVLILHLKCYD
YKSDACSKIIKNFDFQVDLRIDAKLLSNRNKYTGKERNYKLVAVVYHDGKEASKGHYVTD
AYHVGYGCWLRYDDVIVRSVPESHVLKPRAPRVPYLLYYRRADTIGPTK
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggcttcagttcctcgatttgactgatgccacagaaaatgatcagtcattcata
gaacgagttctcttttcaaataatcaagtgttggaagtgccttggaacactaggcatgct
aaggaatctgaagttgaagttgaacaagaatggaccaatgtttcctacactaatgaattt
gagcgagatcaagacttgcaaacacataatcaagtccaagagcctcttagtgacaatgag
caatgcagggaagaagtgcaaaatgaaggaaatcatcaggagcactcagatcaaattcct
caacaagagcatgttcctcgccaaggaggtatctttcctggccacccaccaacatcgatg
cctcaccaacctcagatgtatcaaatgctgccttctctttctaatgtatacgtttccaac
gtaactgctaacgtgaacgttcatgctccttatgttcagcccattcctgcaccttacggt
caccaagttccccctcagcaacagcagccgccacaacaaatgttttctcacggtccacct
gaaggaagtgatcaaggtaatcgtagtcgtcgacagcgtcaaaaagccgaaaaaaagcga
gaggggccttttgttcaatcgaacgaagtaatatcaccttctttagatggtcatcctcct
cctcaatttcccaatattcctcccatgccgccttattacttgcccggggcacctggggcg
cctgtgtatatgcaacatgcaattttacccgtgtatccttcccccttatttaccccatat
agtcataccccaggaccaatggtctatccacaaacaaataacattgaacacggttctgaa
gattacaatggtaatgtacaacaaagtttctctcaagaaaattcggaaatgattgtggtt
gggtgtgagattcgctcggaaaattcgtccgatcaaagaagaggggtggaagaaaacgga
aacaattataacattgaagaattatctgaacaagctattccagaggtgacaggctttaaa
tcaggttcagaaaactctcaatttcacgaagaaagtgctgatggacaattagatcagact
tttgtatctcaacaaaatagtggatcttatgataattcatccaaaagagatttaagtggt
aacatatttgaaaaaaaagaaaaagaagtagaaagcgatgtagataatgtaaaacaaatt
actttcggagatcaaactgctcatttaattagtacctctaatgaagaccccaacaatttg
cctcctgatgttttaaataaaagtaccacatcgaaaaagaaaactaatggtgaacttgat
gtaaataatgtggataaagttagtgtaaatagcaattccagtgcaactgcttgggcgaat
gacggacattcatcagtgcttcattcgggcacgaataacgtaaaacttttcagcagtgct
agtgcgcaagtggttaaagctcaagaaagtttagtgccagcttctcaacagagtagtgaa
ttccctcttatccgacaaggcaccaaatctacacgttttgcattagcagcagttgaacca
gaacctgcatctaatcaaatcaattcatcatccggaggaaaaagttgggctagtcttttt
aataagcaagagcaattaaattcaaactccggatcagatgtaaaaggacgtccactagcg
cgagttttaccgtatgaagttgacactcccagtactggtctctcttccgcaggaccgtct
tctacaattgtgccttctgcctcggtcaaagttagtaaactaggaggagtcacaagtaat
ggtcctcttactcaagaaacagttacatcttcagatctttacgaactggaacataaaata
attagtcttcaacctcggggattgacaaatcgaagtaattggtgctatgtaaatgccgtt
cttcaatctctcatagcttgccctccattctacaatttattgaaagcattaccggttaca
cctaacaaaaagggaaataagcaaactttaattgtagatgctttggtggagtacgccaat
gaatttagtccaatacctgccaatgctagaattggaaagcgggaaaagtcagctcgaaac
aaagacgaaaataatattgttgaaatagttacaggacctgcatttgaaccttctggcata
tataaaattttagataaggtgcgaggaggaagtagtttcaatgttgagggtagacaagaa
gacgcagaagagtttttgtcttgtctgctcaatggacttaacgacgaaatgtttgagctt
atgaaaatggttggaatcaacaggcttgatttggctaatggagatgctcacgattctttg
ggtggaaacattgatgatgatgattctgaatggaacgtgatgggacccaaaaataaaagt
tcaatcactcgtcgagctgtatgtggcaagacacctgtatcggatatttttcgagggcag
tttaggtcaagagttcaacgtgctggagaacaatcgactgatacggttcaaccatttttt
acccttcaattagacattgaaaaagccaattcagtaaaagacgctttagaactttttatg
ggaaaagatcctttggaaggagttacttgttcaaaaactcatcaagaggttgaggcgtgg
acacaaacaactttagaggatcttccacttgttttaatacttcatctcaaatgctatgat
tacaaatccgatgcctgctcaaagattattaaaaattttgatttccaagtagacttgaga
attgatgccaagttattatcaaatagaaataaatatacaggaaaggaaagaaattataaa
ttagttgcagttgtttatcatgatggaaaagaagctagtaaaggtcattacgtaaccgat
gcttatcatgttggatatgggtgttggttgaggtacgatgatgttattgttcgttcagtt
cctgaatctcacgtgcttaaaccacgtgccccgagagtcccttatttattatattatcgt
cgagcagatacaattggtccgacaaaataa

DBGET integrated database retrieval system