KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM356520Help
Entry
Phum_PHUM356520   CDS       T01223                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phum_PHUM356520
   00052 Galactose metabolism
    Phum_PHUM356520
   00500 Starch and sucrose metabolism
    Phum_PHUM356520
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM356520
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Phum_PHUM356520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 509 aa AA seqDB search
MGLELIIFHVKEHKRMPSGAQEFKENVKRDAKNQLQNELKNLRETVSEEERINIEKQHDG
FSRLFERFLEEGGPSVDWNKIEKLPPEAIINHQDLPEPSSDEICRMLNKLIVVKLNGGLG
TSMGCHGPKSVIPVRSDFTFLDLTVQQIEYLNKKYNVDVPLVLMNSFNTEEDTEKIIQKY
KHFRLKIYTFNQSCYPRINRDTLMPMPTSINVKKDIDKWYPPGHGDFYESFRDSGNLEMF
INEGRQYCFISNVDNLGATIDLKILALVMQEKENSPEFVMEVTDKTRADVKGGTLTFYEN
KLRLLEIAQVPEEHVDDFKSIKSFKFFNTNNLWVNLKAMKRILEEKTLNMEVIVNHKHLE
SGYNVIQLETAVGAAMKCFNGCVGVNVPRSRFLPVKKTSDLMLVMSNLYNLKNGSLSMSP
KRMFPTTPLVKLGDQHFSKVKDFLSRFATIPDIIELDHLTVSGDVTFGRNVTLKGTVIII
ANHGDRIDIPSGACLENKIVSGNLRILDH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagaattaattatattccacgtaaaagaacataaacggatgccctcgggtgca
caagaatttaaagaaaacgttaaaagagatgctaaaaatcaattacaaaacgaattgaaa
aatttaagggaaacagtttcggaagaggaaaggataaatattgaaaaacaacacgatgga
ttttcaagacttttcgaaaggtttctcgaagaaggtggtccatcggtggattggaataaa
attgaaaaattaccaccggaagcgattatcaatcatcaagatcttccagaaccatcttcg
gatgaaatatgtcgtatgttaaataaattaatagttgttaaattgaatggaggattaggg
acttcaatgggttgtcacggacccaaatccgtcattcccgtcagaagcgattttacattt
ttagatttaaccgtacaacaaattgaatatttgaataaaaaatacaacgtcgacgtccca
ctcgtactcatgaattcattcaacacggaagaagacacggaaaagataatacaaaaatac
aaacactttcgtctcaaaatatacactttcaatcagagttgttacccgcgaataaatcgc
gacactctcatgcccatgccgacgagcataaacgtgaaaaaagatatagacaaatggtat
cctccgggtcacggtgatttttacgaaagttttcgagattctggtaatctcgaaatgttc
ataaacgaaggacgtcaatattgtttcatatcgaatgttgataatttaggcgcgaccatt
gatttaaaaattttggctctcgtcatgcaagaaaaagaaaattcaccggaattcgtgatg
gaagtcacggacaaaacgcgagccgacgttaagggaggtactctgacattttacgaaaac
aaattaagactattagaaatagctcaagtgccggaagaacacgtggacgatttcaaatcg
ataaagtcctttaaatttttcaacacgaacaatctctgggtcaatttgaaagcaatgaaa
agaatattggaagagaaaactctcaacatggaagtcattgtcaatcacaaacacctcgaa
tcgggttacaacgtgatacaactcgaaacggccgtgggtgccgccatgaaatgttttaac
ggttgcgtcggagtcaacgttccgagaagcagattccttccggttaagaaaacatccgat
ctcatgttggtcatgagtaatttgtacaatttaaaaaatggatccctgagcatgagcccg
aaaagaatgtttccgactacgcctttggttaaattaggagatcaacatttttcaaaggta
aaagattttttatctcgtttcgcaaccataccggatatcatagaattagatcatttgacc
gtttcgggagacgtcacgttcggacgtaatgtcactcttaagggaaccgtcatcataata
gccaatcacggtgacagaatagatataccctcaggagcgtgtttagaaaataaaatagtt
tctggaaatttaagaatattggatcattag

DBGET integrated database retrieval system