KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM356520Help
Entry
Phum_PHUM356520   CDS       T01223                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase, putative
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00040  Pentose and glucuronate interconversions
phu00052  Galactose metabolism
phu00500  Starch and sucrose metabolism
phu00520  Amino sugar and nucleotide sugar metabolism
phu01100  Metabolic pathways
Module
phu_M00361  Nucleotide sugar biosynthesis, eukaryotes
phu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Phum_PHUM356520
   00052 Galactose metabolism
    Phum_PHUM356520
   00500 Starch and sucrose metabolism
    Phum_PHUM356520
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM356520
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Phum_PHUM356520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DUF836
Motif
Other DBs
NCBI-GeneID: 8232060
NCBI-ProteinID: XP_002427960
VectorBase: PHUM356520
UniProt: E0VPB6
AA seq 509 aa AA seqDB search
MGLELIIFHVKEHKRMPSGAQEFKENVKRDAKNQLQNELKNLRETVSEEERINIEKQHDG
FSRLFERFLEEGGPSVDWNKIEKLPPEAIINHQDLPEPSSDEICRMLNKLIVVKLNGGLG
TSMGCHGPKSVIPVRSDFTFLDLTVQQIEYLNKKYNVDVPLVLMNSFNTEEDTEKIIQKY
KHFRLKIYTFNQSCYPRINRDTLMPMPTSINVKKDIDKWYPPGHGDFYESFRDSGNLEMF
INEGRQYCFISNVDNLGATIDLKILALVMQEKENSPEFVMEVTDKTRADVKGGTLTFYEN
KLRLLEIAQVPEEHVDDFKSIKSFKFFNTNNLWVNLKAMKRILEEKTLNMEVIVNHKHLE
SGYNVIQLETAVGAAMKCFNGCVGVNVPRSRFLPVKKTSDLMLVMSNLYNLKNGSLSMSP
KRMFPTTPLVKLGDQHFSKVKDFLSRFATIPDIIELDHLTVSGDVTFGRNVTLKGTVIII
ANHGDRIDIPSGACLENKIVSGNLRILDH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagaattaattatattccacgtaaaagaacataaacggatgccctcgggtgca
caagaatttaaagaaaacgttaaaagagatgctaaaaatcaattacaaaacgaattgaaa
aatttaagggaaacagtttcggaagaggaaaggataaatattgaaaaacaacacgatgga
ttttcaagacttttcgaaaggtttctcgaagaaggtggtccatcggtggattggaataaa
attgaaaaattaccaccggaagcgattatcaatcatcaagatcttccagaaccatcttcg
gatgaaatatgtcgtatgttaaataaattaatagttgttaaattgaatggaggattaggg
acttcaatgggttgtcacggacccaaatccgtcattcccgtcagaagcgattttacattt
ttagatttaaccgtacaacaaattgaatatttgaataaaaaatacaacgtcgacgtccca
ctcgtactcatgaattcattcaacacggaagaagacacggaaaagataatacaaaaatac
aaacactttcgtctcaaaatatacactttcaatcagagttgttacccgcgaataaatcgc
gacactctcatgcccatgccgacgagcataaacgtgaaaaaagatatagacaaatggtat
cctccgggtcacggtgatttttacgaaagttttcgagattctggtaatctcgaaatgttc
ataaacgaaggacgtcaatattgtttcatatcgaatgttgataatttaggcgcgaccatt
gatttaaaaattttggctctcgtcatgcaagaaaaagaaaattcaccggaattcgtgatg
gaagtcacggacaaaacgcgagccgacgttaagggaggtactctgacattttacgaaaac
aaattaagactattagaaatagctcaagtgccggaagaacacgtggacgatttcaaatcg
ataaagtcctttaaatttttcaacacgaacaatctctgggtcaatttgaaagcaatgaaa
agaatattggaagagaaaactctcaacatggaagtcattgtcaatcacaaacacctcgaa
tcgggttacaacgtgatacaactcgaaacggccgtgggtgccgccatgaaatgttttaac
ggttgcgtcggagtcaacgttccgagaagcagattccttccggttaagaaaacatccgat
ctcatgttggtcatgagtaatttgtacaatttaaaaaatggatccctgagcatgagcccg
aaaagaatgtttccgactacgcctttggttaaattaggagatcaacatttttcaaaggta
aaagattttttatctcgtttcgcaaccataccggatatcatagaattagatcatttgacc
gtttcgggagacgtcacgttcggacgtaatgtcactcttaagggaaccgtcatcataata
gccaatcacggtgacagaatagatataccctcaggagcgtgtttagaaaataaaatagtt
tctggaaatttaagaatattggatcattag

DBGET integrated database retrieval system