KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM357590Help
Entry
Phum_PHUM357590   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.12.2)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Phum_PHUM357590
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Phum_PHUM357590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 613 aa AA seqDB search
MASVPDLAPFLRKPRMGVPQKVRPVMKLEWNKLLAEATEKDVELKKDSIDDEVYYDDDFE
FTGENESNVKTNSEENQEGKPLNLCSKSHTLPGSSISFQKNIDILDLSAKKVMPENKNVR
KSSEFKKNSNSSSFSNFQLNDFSNEKIIKETTSNNSKEVQDCNVENKENFNSNYLKNIYC
TPSNTKPPISEHNGKNFQENDLIKSCKVKDVQNKPNLIFYSEKKLTSKNALLEKEKIIKE
EIIRKQDLILKKGKPEMNDKIKNISEKMVKTKPSSQVATPVSKFAVPATPKSKESSKVLV
INKKSYQILAPLGKGGSSKVYLVLNSENELLAVKCVRLSDVSESTKNDYLNEIQHLMKMQ
HCKHVIKLYDHQYLSSQKILFAVMERGETDLSRFLKDKASSDEGISPELIMYYWTEMLMA
VKSIHDNNIIHRDLKPANFLLVSGRLKLIDFGIASSIQTEQTSILMESQSGTFNYMSPEA
LQDLGFDNKIVLKIGRKTDVWSLGCILYYFLYKKTPYQDLVKPLHKLKAITDPNYSVPFP
KISGVPDILIESCKRCLIHDTKKRASIEELLAFRNRPLFSLSQVLGKLKDILDPNEYKKA
ENAFEDASNRMKG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtgccagatttagctccgtttcttaggaaacctcgtatgggcgtccctcaa
aaagttcgtccggtgatgaaattagagtggaataaactattggctgaagccactgaaaaa
gatgttgagttaaaaaaagatagcattgatgatgaagtttattacgatgatgattttgag
tttacaggggaaaatgaatcaaatgtcaaaactaattctgaagaaaatcaagaaggaaag
cctttgaatttgtgtagcaaatctcacacccttccgggttctagcatttcttttcagaaa
aatattgacattctagatttatctgctaagaaggttatgcctgaaaataaaaatgttaga
aagtctagtgaatttaaaaaaaatagtaattctagttcattttctaactttcaattaaat
gatttttctaatgaaaaaattataaaagaaacaactagtaataacagtaaagaagttcag
gactgcaatgttgaaaataaagaaaactttaatagcaattacttaaaaaatatatattgc
acaccgtctaacactaagcctccaatttctgaacataatgggaaaaattttcaagaaaat
gacttgattaaaagttgtaaagtgaaagatgttcagaataaaccaaatttaattttttac
agtgaaaaaaaactaacatcaaagaatgccttattggaaaaagaaaaaattatcaaagaa
gaaattattagaaaacaggatttaattttaaaaaaagggaaaccagaaatgaatgataaa
atcaaaaatatttctgaaaaaatggtcaaaactaaaccatcatcacaagttgctacccca
gtttctaaatttgctgttcctgctactcctaaatctaaagaatcatcaaaagttttagta
attaataaaaaatcttatcaaattttagcacctctcggaaaaggtggatctagcaaagtt
tatttggttcttaattctgaaaatgaattattagctgttaaatgtgttaggttatcggat
gtctcggaaagtaccaaaaatgattatctaaatgaaattcaacatttgatgaaaatgcaa
cactgcaaacatgttataaaactttatgatcaccaataccttagttctcaaaaaatatta
tttgctgtaatggaaaggggtgaaacagatttatcaagatttttaaaagacaaagcatcc
agcgatgaaggtatttctccagagctgattatgtattattggacagaaatgctaatggct
gtcaaaagcattcacgataacaatataattcacagagatttaaaaccagcaaactttctt
ttagtttccggtcgattaaaattaatagattttggtatagcttcttctatacaaacagaa
caaacaagcattttaatggaatcgcagtcaggtacatttaattatatgagtccggaagca
ttgcaagatttaggtttcgataataaaatagtgttgaagatcggtcgaaaaacagatgtt
tggtcattgggatgtattttatattattttctatacaaaaaaactccatatcaggatttg
gtgaaacctctgcataagttaaaagcaattactgacccaaattattcagtaccttttcca
aaaatatccggagttccagatattctcattgaatcgtgtaaaagatgtttgatacacgac
acgaaaaaacgagcatccatcgaagaattattagcatttagaaatcgtcctcttttttcg
ttatctcaggttttgggaaaattaaaggatatacttgatccgaacgaatataagaaagca
gaaaatgctttcgaagatgcttctaaccgaatgaaaggctaa

DBGET integrated database retrieval system