KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM361420Help
Entry
Phum_PHUM361420   CDS       T01223                                 

Definition
calcium-binding protein p22, putative
Orthology
K17610  
calcineurin B homologous protein 1
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Protein phosphatases and associated proteins [BR:phu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Phum_PHUM361420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 194 aa AA seqDB search
MGNNASLLLREEEIAQIQEETGFTPKQIERLYSRFTSLDRGESGTLSREDFLRIPELAIN
PLGDRIVHAFFEQGCSDRVNFLQFMQVLAHFRPIKKNKDNKLNSREQKLRCKYIIFAFKM
YDLDNDDKISRDELLAILHMMVGANISEEQLSSIAERTILEADKNCDQMISFEEFCRALE
RTDVEQKMSIRFLN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaatgcatcattattattaagagaagaagaaatagcacaaatacaagaagaa
actggatttactccaaaacaaattgaaaggctctacagtagatttacaagccttgacaga
ggtgagagtggaactcttagcagagaagattttttaagaatccctgaacttgcgattaat
ccattaggcgatagaattgttcatgcttttttcgaacaaggatgcagcgacagagtcaat
tttttacaatttatgcaagttttagctcatttcagacctattaaaaaaaataaagataat
aaattaaattcaagagaacaaaagttaagatgtaagtacatcatttttgcctttaaaatg
tacgatcttgataatgatgataaaatatcgagagatgaactattagcaatattacacatg
atggtcggggctaacataagcgaagaacagttaagtagcatagcagaacgtacaatatta
gaagctgataaaaattgcgatcaaatgatctcattcgaagaattttgtcgagcactagaa
agaactgatgtcgaacaaaaaatgtctattcgatttttgaattga

DBGET integrated database retrieval system