KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM366120Help
Entry
Phum_PHUM366120   CDS       T01223                                 

Definition
aldose 1-epimerase, putative (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM366120
   00052 Galactose metabolism
    Phum_PHUM366120
Enzymes [BR:phu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Phum_PHUM366120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 507 aa AA seqDB search
MEGEYFPCPKPEEPFVTITEDGFGFVTNQDGSREVVRRYTFTNQNYLTIQVITYGAAITS
IKYPDKKGSLDDIVLGFDDIEGYLSPKNPYFGATVGRVANRIAKGHFRIGDEDYQLSTNI
GEHHLHGGFKGFDKANWKGEVQGKKVVMTYLSKDKEEGYPGEVLACVLFEMTTDNDFIIE
MKATSTKPTPINLTNHSYFNLAGHDKGAYGLYQHVISINADKYCHTDENYIPSGMLKNVV
NTLWDLRIGKKLGGVINYVPYGGYDQNMCIHKTSSECLSFIARVYHPESGRTLEVYSNQP
GVQFYTSNSLPSRPSGDAVVCMKKLGIKGKQGVHYYKHQAFCLETQNYPDAVNHVSIKTE
LGEDNCLIRKCPLCGQLIKDADFENLNDEEFGDKNTMENYQNSIEIYKLIGKSGTLYYKH
AAFCLMTQKYPDSVHRKNFPNSILKPGENYYHIVKYKFAVYEEVIPHQEEEEYVENSEPE
VEGEFVQPEVTDEDDILNFQETISTLG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgaatattttccttgtcctaaaccagaagaaccatttgtcacaattacagaa
gatggatttggttttgtaacaaatcaagacggttccagagaagtagttcgaagatacact
tttaccaatcaaaattatttaaccattcaagtcataacttacggggcagctataacatcc
attaaatatcctgataaaaagggatctctagatgacattgttttaggatttgatgatata
gaaggttatttatcaccaaaaaatccatattttggtgcaactgttggaagagtggccaat
agaattgcaaaaggtcattttagaattggtgacgaagattatcagctgagcaccaatata
ggagaacatcatttacatggtggttttaaaggatttgataaagctaattggaaaggagaa
gttcaagggaaaaaagttgtcatgacatatctcagtaaagacaaagaagagggctatcca
ggtgaagttttagcatgtgttctgtttgaaatgactactgataatgattttattattgaa
atgaaagccacttccactaaaccaactcctattaatttaactaatcattcatatttcaat
cttgctggccatgacaaaggtgcatatggcttatatcaacatgtaatatcaataaatgcg
gataagtattgtcacacagatgaaaattatataccatctggaatgttgaaaaatgtagta
aatactctgtgggatttgagaataggaaaaaaattaggaggagttattaattatgtaccc
tatggaggatatgatcaaaatatgtgtattcataaaacaagtagtgaatgcctatcattc
attgcaagggtataccatcctgaaagtggcagaacattagaagtttattctaaccagcca
ggtgttcagttttatacatctaacagcctcccgagtaggccaagtggagatgctgttgta
tgcatgaaaaaattgggtataaagggcaaacaaggagtacattattacaaacaccaggct
ttctgtctggaaacgcaaaattatccagatgctgtcaatcatgtgagtattaaaactgag
ttgggtgaagataattgtctgataagaaaatgtcccctttgtggccaacttattaaagac
gctgattttgaaaatttaaatgatgaggaatttggagataaaaatactatggaaaattac
caaaactctattgaaatttacaaattgattggtaaatctggaacattatattataagcat
gcagcattttgtttgatgacacaaaaatatcctgattcagtgcatcgtaaaaatttccca
aattctatattaaaacctggggaaaattattatcacattgtcaaatataaatttgctgtg
tatgaagaagttattccacatcaggaagaagaagaatatgtagaaaattctgaacctgaa
gtggaaggagaatttgtacaacctgaagtaacagatgaagatgatattcttaactttcaa
gaaactatcagtactctgggatag

DBGET integrated database retrieval system