KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM366140Help
Entry
Phum_PHUM366140   CDS       T01223                                 

Definition
(RefSeq) ras GTP exchange factor, son of sevenless, putative
  KO
K03099  son of sevenless
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
phu04068  FoxO signaling pathway
phu04150  mTOR signaling pathway
phu04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM366140
   04068 FoxO signaling pathway
    Phum_PHUM366140
   04150 mTOR signaling pathway
    Phum_PHUM366140
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Phum_PHUM366140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH PH_13 PH_10
Motif
Other DBs
NCBI-GeneID: 8233474
NCBI-ProteinID: XP_002428152
VectorBase: PHUM366140
UniProt: E0VPV8
AA seq 1507 aa AA seqDB search
MFSSPSSAIESQNYDFEKAENAAKWKGVFVNSLRKVLEQVHSSLTARDDALEYVESLILR
LLGMLCARPPPHTTQDVEERVRRTFPTPIDRWALTDAKEAIEKGKKKSPLVLPVDRVHHL
LQKEVLQYKLDSQVSFYIVAVLEYISADILKLAGNYVKNIRHVEITCQDIRVAMCADKVL
MDMFHQDEGGSSSSTATIEESEGIQPRTSLTYEEVVKDLIHDEKQYLRDLHMIIKVFREE
IAKLTNNPKDLEDMFSNIMDIYELTITLLGSLEDMVEISEEKQLPAVGSCFEELAEAAEF
DVYGKYARDMMSSKSREALHRLLSRPEVSETLHTAGQGFCEAVKYYLPKLLLGPVWHCFL
YFDYMKVLNKLTPMVEDKESLEQVEGLLRPLQMELTSLIGNVARRDTNVRMHSRVRRQIA
IEKTNELQRSIDGWEGKDIGQCCNEFIREDVLGKLSSGKRLTERRAFLFDGLMVLCKPNS
KRTSVSVTTQQTTAEFRLKERFFIRKVYITDKEDTEDLKNAFEISPRVQPSVILVAKSPE
DKNIWMADLIMLNTKSMLDRLLDSILLDEEKKHPLKLPPPHLYKFAEADSKDNIVLDETE
GSGVPLIKGATLYKLIERLTYHIYADPMFVRTFLTTYRSFCSPQELLDLLVERFNIPEPQ
LFYDDNKETSESDKTIKNSQREDWKRFRKEYCQPVQFRVLNVLRHWVDHHFYDFERDATL
LEKLHHFLDTVNGKSMRKWVDSVLKIVQRKCDSNEIQREITFAFDRSPPPIEWHIRCPEE
EWSILTLHPIEIARQLTLLEFELYRAVKPSELVGSVWTKKDKEKTSPNLLKMIKHTTNFT
RWLEKNIIDAENLEERIAIVSRIIEVMMVLQELNNFNGVLAVVSAMGSAGVFRLKFTFQA
LSARLDKALEEARELNAGHFKKYQQKLRSINPPCVPFFGMYLTNILFIEEGNPDYLPNSP
KLINFSKRRKVAEITGEIQQYQNQPYCFSVELKIRHFLENLCPFENQTDAEIGNYLFNKS
LEIEPRMCKQPPRFPRKWPELNLKSPGTKPKNLPGRSHPPMPLPSIDRHRSPSTMRLQED
QEPETPKTPHTPPHRPTPDLIDNTVFMPVLIGGRSGNQSPGGQVLVSSATPSPGTSPSPA
HPPALPPPPPPPAKSIELVRLPSSKIVRSAVAPPLPPRRKKENSTGESIPDVPPRDQSPP
PLPPRSNPSHLQRRNSALDVGQNEGQTTVPRRHMSVNGPFLSTMPRSGHKALPVNHQIST
MPAPTFHVPNHSQDTQSHGQGVPPFYGHLSFGSHNLQATQTAILGTHNLSQSCRNSGNFN
FNTNKPVTIGTGMTGMTTTTTPPITTAPHPLRHHPHVRNFENVLENLELNNASSPTRKTS
HNFNFKSNSSDIDKQQQKTILTAYGKNENSPKLLPENLGIPYPGEELSNRLTAVSPQKST
KEIKSSRLSGNQEDIHLNCILSTPELPPKIHLGKKSPVYAKGSGETLFHFDSQKIHRMNS
SSQDGHS
NT seq 4524 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcaccaagttctgccatagaatcccagaattatgattttgaaaaagcagaa
aatgctgcaaagtggaaaggtgtttttgttaactctttacgaaaagtcttggaacaagtc
cattcgtcactgacagctcgtgatgatgcattagaatatgtagaatcattaatacttcgg
ctgttgggtatgctttgcgctagacctcctcctcataccacccaagatgtcgaggagaga
gtacgaagaacgtttcccacacccattgacagatgggcactcaccgatgccaaagaggcg
atagaaaaagggaaaaaaaaatcaccgttggtgctacccgtcgatagagttcatcattta
ttgcaaaaggaagtcttgcaatataaattggactctcaggtatccttctacatagttgcc
gtgcttgaatatatatcggcagatattttgaagctggccggcaactatgttaaaaacatt
cgtcatgtagaaatcacttgccaagacataagagttgctatgtgtgcggacaaggtattg
atggacatgtttcatcaagacgaagggggatcatcatcatcaacggcaacaattgaagaa
tcagaaggaatacaaccgagaacatctctcacgtacgaagaagttgttaaagatttgata
cacgacgaaaaacaatacctgagagatcttcatatgataataaaagtttttagagaagaa
attgcaaagttaaccaacaatccgaaggatttagaagatatgtttagtaatataatggat
atatacgagctgacaattacattgttaggatctctagaggatatggttgaaatttcagaa
gaaaaacaacttcctgctgtcggtagttgcttcgaagaattggcagaggcggccgagttt
gacgtatacggtaaatatgcaagagacatgatgtcttccaagtctcgcgaagctttacat
cgacttctttctcgtcctgaagtatccgaaactcttcacacggcgggacaaggtttttgt
gaagctgtcaaatattaccttccaaagcttctcttaggacccgtatggcattgctttttg
tattttgactacatgaaagtgctcaataagttgactcccatggtggaggataaagaaagt
ttggaacaggtcgaaggattacttcgaccgcttcaaatggaattaacgtctttgattggt
aacgtcgctaggcgagatacgaatgttagaatgcacagtcgtgtaagaagacaaatcgca
atagaaaaaacgaacgaacttcaaagatccatcgacggttgggaagggaaagatataggg
caatgttgtaatgaatttattagagaggatgttttgggaaagcttagttcgggaaaaagg
ttaactgaaaggagagcttttcttttcgatggtttaatggttctttgtaagccaaattct
aaaagaacatcagtttccgtcacgacacagcaaacaactgctgaattcagattgaaagaa
agattttttattagaaaagtgtacataaccgataaggaagacacagaggatttaaaaaat
gcatttgaaatatctccaagagttcaaccaagtgtgattctagttgccaaatctcccgaa
gataaaaatatttggatggcagatttaataatgcttaacactaaaagcatgcttgatagg
ttattagatagcatattgttggatgaagaaaaaaaacatccattaaagttgcctcctcca
catttgtacaaatttgccgaagccgattctaaagacaatattgtcttggatgagactgaa
ggttctggtgtgccacttataaagggtgcaactttgtacaaattaattgaaagactgact
tatcacatttatgctgatccaatgtttgttcgtacgttccttacgacttaccgtagtttc
tgtagtccgcaagaacttttggaccttcttgtggaaaggttcaacattcccgagcctcaa
ctcttttacgacgataataaggaaacttccgaatcggacaaaacgataaaaaattcacaa
agagaagactggaagaggtttagaaaagaatattgtcaaccggttcaatttagagtttta
aatgtacttcggcactgggtcgatcatcacttttacgatttcgaaagagacgctacgctc
cttgaaaaacttcatcattttctcgataccgttaatggtaaaagtatgaggaagtgggtt
gattcggttttgaagattgtacaaaggaaatgcgattcgaatgaaatacaaagagaaata
acttttgcatttgatagaagtcctcctccgatcgaatggcatatcaggtgtcccgaagaa
gaatggagcatattaacgcttcatcccatcgagatcgctcgacaactgacgctcttagaa
ttcgaactttatcgagctgttaaaccttcggaattagtcggttcggtttggacgaaaaaa
gacaaagaaaaaacttctccaaatttattaaaaatgataaaacatacgactaattttaca
aggtggcttgaaaaaaatataatcgacgccgaaaatttagaagaacgaatagccatagtt
tctagaataatagaagttatgatggtgcttcaagagttaaataattttaatggtgtactc
gcggtggtctcggccatgggatccgctggggttttccgattaaaatttacttttcaggca
ttgtcagcgagattagataaggctttagaagaagcgagagaattaaatgctggacatttt
aaaaaatatcagcaaaaattaaggtctattaatccgccttgcgtaccttttttcggcatg
tatttaacaaacattttatttatcgaggaaggaaatccagattacttgcctaattctcct
aaactgattaactttagtaaaagaagaaaagtggcagaaatcacgggagaaattcaacaa
taccaaaatcagccatattgttttagcgtcgaattaaaaattagacactttttagaaaat
ttatgtccgtttgaaaaccaaacagacgcagaaataggaaattatctttttaataaatca
ttagaaatagaacctagaatgtgtaaacaacctcctagattcccgagaaagtggccagaa
ttaaatttaaaatcgcccggtacgaaaccgaaaaatctacccgggcgaagtcatcctcca
atgccgttgccatctatcgatcgtcatagatcaccgtctaccatgcgattacaagaggat
caagaaccggaaacgcctaaaactcctcacactccgcctcataggcctacgccagatctt
atcgataatactgtttttatgccggttttaataggaggccgatcaggaaatcaatcccct
ggaggccaagtattagtatcctctgccactcctagtcccggtacgagtccgtctccggct
catcctcccgctcttccaccaccgccgcctcctcctgctaaatcaatcgaactcgttcga
cttccttcttcgaaaatagttagatctgccgttgctcctccccttcccccaaggcggaaa
aaagaaaattccacgggagaatcaatcccggatgttcctccgcgtgatcagtcacctcct
ccgcttcctcctcgcagtaatccgtcccatttgcaaaggcgtaattccgccctagatgtt
ggccaaaatgaagggcaaacgaccgtgccaaggcgtcacatgtcagtaaacggacccttt
ctaagcacaatgcccagatccggtcataaggcgttaccagttaatcatcaaatatcaact
atgccagcaccgacatttcacgtcccaaatcattctcaagatacccaatcgcacggtcaa
ggcgtgccgccattttacggacatttgtctttcggaagtcataatcttcaagcaactcaa
accgccatattaggaactcacaacttgtcgcaaagttgtagaaattcgggaaattttaat
tttaatacaaacaagcccgtaacgatcggaacgggtatgacgggtatgacgacgacgacg
actcctccaatcacgaccgctcctcatccccttcgccaccaccctcacgtaagaaatttc
gaaaacgtattagaaaatttagaattgaacaatgcgagttctccaacgagaaaaactagt
cacaattttaactttaagtcgaattcgagcgatatcgataagcaacaacagaagacgatt
ttaactgcgtacggtaaaaatgaaaattcacccaaattgttaccggaaaatctgggaata
ccgtatccgggcgaagaactttcaaatcggttgacggccgtgtcacctcaaaaatccacg
aaagaaataaaatcatcgaggctttcgggaaatcaagaagacatacatttgaactgcata
ctttccactccggaacttcctccgaaaattcatttgggtaaaaaaagtccagtgtatgcc
aagggaagcggagaaacgttgtttcatttcgattcgcaaaaaatccatagaatgaatagt
tcttctcaggatggccacagttaa

DBGET integrated database retrieval system