KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM366140Help
Entry
Phum_PHUM366140   CDS       T01223                                 

Definition
ras GTP exchange factor, son of sevenless, putative
Orthology
K03099  
son of sevenless
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:phu04013]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:phu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:phu04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:phu04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1507 aa AA seqDB search
MFSSPSSAIESQNYDFEKAENAAKWKGVFVNSLRKVLEQVHSSLTARDDALEYVESLILR
LLGMLCARPPPHTTQDVEERVRRTFPTPIDRWALTDAKEAIEKGKKKSPLVLPVDRVHHL
LQKEVLQYKLDSQVSFYIVAVLEYISADILKLAGNYVKNIRHVEITCQDIRVAMCADKVL
MDMFHQDEGGSSSSTATIEESEGIQPRTSLTYEEVVKDLIHDEKQYLRDLHMIIKVFREE
IAKLTNNPKDLEDMFSNIMDIYELTITLLGSLEDMVEISEEKQLPAVGSCFEELAEAAEF
DVYGKYARDMMSSKSREALHRLLSRPEVSETLHTAGQGFCEAVKYYLPKLLLGPVWHCFL
YFDYMKVLNKLTPMVEDKESLEQVEGLLRPLQMELTSLIGNVARRDTNVRMHSRVRRQIA
IEKTNELQRSIDGWEGKDIGQCCNEFIREDVLGKLSSGKRLTERRAFLFDGLMVLCKPNS
KRTSVSVTTQQTTAEFRLKERFFIRKVYITDKEDTEDLKNAFEISPRVQPSVILVAKSPE
DKNIWMADLIMLNTKSMLDRLLDSILLDEEKKHPLKLPPPHLYKFAEADSKDNIVLDETE
GSGVPLIKGATLYKLIERLTYHIYADPMFVRTFLTTYRSFCSPQELLDLLVERFNIPEPQ
LFYDDNKETSESDKTIKNSQREDWKRFRKEYCQPVQFRVLNVLRHWVDHHFYDFERDATL
LEKLHHFLDTVNGKSMRKWVDSVLKIVQRKCDSNEIQREITFAFDRSPPPIEWHIRCPEE
EWSILTLHPIEIARQLTLLEFELYRAVKPSELVGSVWTKKDKEKTSPNLLKMIKHTTNFT
RWLEKNIIDAENLEERIAIVSRIIEVMMVLQELNNFNGVLAVVSAMGSAGVFRLKFTFQA
LSARLDKALEEARELNAGHFKKYQQKLRSINPPCVPFFGMYLTNILFIEEGNPDYLPNSP
KLINFSKRRKVAEITGEIQQYQNQPYCFSVELKIRHFLENLCPFENQTDAEIGNYLFNKS
LEIEPRMCKQPPRFPRKWPELNLKSPGTKPKNLPGRSHPPMPLPSIDRHRSPSTMRLQED
QEPETPKTPHTPPHRPTPDLIDNTVFMPVLIGGRSGNQSPGGQVLVSSATPSPGTSPSPA
HPPALPPPPPPPAKSIELVRLPSSKIVRSAVAPPLPPRRKKENSTGESIPDVPPRDQSPP
PLPPRSNPSHLQRRNSALDVGQNEGQTTVPRRHMSVNGPFLSTMPRSGHKALPVNHQIST
MPAPTFHVPNHSQDTQSHGQGVPPFYGHLSFGSHNLQATQTAILGTHNLSQSCRNSGNFN
FNTNKPVTIGTGMTGMTTTTTPPITTAPHPLRHHPHVRNFENVLENLELNNASSPTRKTS
HNFNFKSNSSDIDKQQQKTILTAYGKNENSPKLLPENLGIPYPGEELSNRLTAVSPQKST
KEIKSSRLSGNQEDIHLNCILSTPELPPKIHLGKKSPVYAKGSGETLFHFDSQKIHRMNS
SSQDGHS
NT seq 4524 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcaccaagttctgccatagaatcccagaattatgattttgaaaaagcagaa
aatgctgcaaagtggaaaggtgtttttgttaactctttacgaaaagtcttggaacaagtc
cattcgtcactgacagctcgtgatgatgcattagaatatgtagaatcattaatacttcgg
ctgttgggtatgctttgcgctagacctcctcctcataccacccaagatgtcgaggagaga
gtacgaagaacgtttcccacacccattgacagatgggcactcaccgatgccaaagaggcg
atagaaaaagggaaaaaaaaatcaccgttggtgctacccgtcgatagagttcatcattta
ttgcaaaaggaagtcttgcaatataaattggactctcaggtatccttctacatagttgcc
gtgcttgaatatatatcggcagatattttgaagctggccggcaactatgttaaaaacatt
cgtcatgtagaaatcacttgccaagacataagagttgctatgtgtgcggacaaggtattg
atggacatgtttcatcaagacgaagggggatcatcatcatcaacggcaacaattgaagaa
tcagaaggaatacaaccgagaacatctctcacgtacgaagaagttgttaaagatttgata
cacgacgaaaaacaatacctgagagatcttcatatgataataaaagtttttagagaagaa
attgcaaagttaaccaacaatccgaaggatttagaagatatgtttagtaatataatggat
atatacgagctgacaattacattgttaggatctctagaggatatggttgaaatttcagaa
gaaaaacaacttcctgctgtcggtagttgcttcgaagaattggcagaggcggccgagttt
gacgtatacggtaaatatgcaagagacatgatgtcttccaagtctcgcgaagctttacat
cgacttctttctcgtcctgaagtatccgaaactcttcacacggcgggacaaggtttttgt
gaagctgtcaaatattaccttccaaagcttctcttaggacccgtatggcattgctttttg
tattttgactacatgaaagtgctcaataagttgactcccatggtggaggataaagaaagt
ttggaacaggtcgaaggattacttcgaccgcttcaaatggaattaacgtctttgattggt
aacgtcgctaggcgagatacgaatgttagaatgcacagtcgtgtaagaagacaaatcgca
atagaaaaaacgaacgaacttcaaagatccatcgacggttgggaagggaaagatataggg
caatgttgtaatgaatttattagagaggatgttttgggaaagcttagttcgggaaaaagg
ttaactgaaaggagagcttttcttttcgatggtttaatggttctttgtaagccaaattct
aaaagaacatcagtttccgtcacgacacagcaaacaactgctgaattcagattgaaagaa
agattttttattagaaaagtgtacataaccgataaggaagacacagaggatttaaaaaat
gcatttgaaatatctccaagagttcaaccaagtgtgattctagttgccaaatctcccgaa
gataaaaatatttggatggcagatttaataatgcttaacactaaaagcatgcttgatagg
ttattagatagcatattgttggatgaagaaaaaaaacatccattaaagttgcctcctcca
catttgtacaaatttgccgaagccgattctaaagacaatattgtcttggatgagactgaa
ggttctggtgtgccacttataaagggtgcaactttgtacaaattaattgaaagactgact
tatcacatttatgctgatccaatgtttgttcgtacgttccttacgacttaccgtagtttc
tgtagtccgcaagaacttttggaccttcttgtggaaaggttcaacattcccgagcctcaa
ctcttttacgacgataataaggaaacttccgaatcggacaaaacgataaaaaattcacaa
agagaagactggaagaggtttagaaaagaatattgtcaaccggttcaatttagagtttta
aatgtacttcggcactgggtcgatcatcacttttacgatttcgaaagagacgctacgctc
cttgaaaaacttcatcattttctcgataccgttaatggtaaaagtatgaggaagtgggtt
gattcggttttgaagattgtacaaaggaaatgcgattcgaatgaaatacaaagagaaata
acttttgcatttgatagaagtcctcctccgatcgaatggcatatcaggtgtcccgaagaa
gaatggagcatattaacgcttcatcccatcgagatcgctcgacaactgacgctcttagaa
ttcgaactttatcgagctgttaaaccttcggaattagtcggttcggtttggacgaaaaaa
gacaaagaaaaaacttctccaaatttattaaaaatgataaaacatacgactaattttaca
aggtggcttgaaaaaaatataatcgacgccgaaaatttagaagaacgaatagccatagtt
tctagaataatagaagttatgatggtgcttcaagagttaaataattttaatggtgtactc
gcggtggtctcggccatgggatccgctggggttttccgattaaaatttacttttcaggca
ttgtcagcgagattagataaggctttagaagaagcgagagaattaaatgctggacatttt
aaaaaatatcagcaaaaattaaggtctattaatccgccttgcgtaccttttttcggcatg
tatttaacaaacattttatttatcgaggaaggaaatccagattacttgcctaattctcct
aaactgattaactttagtaaaagaagaaaagtggcagaaatcacgggagaaattcaacaa
taccaaaatcagccatattgttttagcgtcgaattaaaaattagacactttttagaaaat
ttatgtccgtttgaaaaccaaacagacgcagaaataggaaattatctttttaataaatca
ttagaaatagaacctagaatgtgtaaacaacctcctagattcccgagaaagtggccagaa
ttaaatttaaaatcgcccggtacgaaaccgaaaaatctacccgggcgaagtcatcctcca
atgccgttgccatctatcgatcgtcatagatcaccgtctaccatgcgattacaagaggat
caagaaccggaaacgcctaaaactcctcacactccgcctcataggcctacgccagatctt
atcgataatactgtttttatgccggttttaataggaggccgatcaggaaatcaatcccct
ggaggccaagtattagtatcctctgccactcctagtcccggtacgagtccgtctccggct
catcctcccgctcttccaccaccgccgcctcctcctgctaaatcaatcgaactcgttcga
cttccttcttcgaaaatagttagatctgccgttgctcctccccttcccccaaggcggaaa
aaagaaaattccacgggagaatcaatcccggatgttcctccgcgtgatcagtcacctcct
ccgcttcctcctcgcagtaatccgtcccatttgcaaaggcgtaattccgccctagatgtt
ggccaaaatgaagggcaaacgaccgtgccaaggcgtcacatgtcagtaaacggacccttt
ctaagcacaatgcccagatccggtcataaggcgttaccagttaatcatcaaatatcaact
atgccagcaccgacatttcacgtcccaaatcattctcaagatacccaatcgcacggtcaa
ggcgtgccgccattttacggacatttgtctttcggaagtcataatcttcaagcaactcaa
accgccatattaggaactcacaacttgtcgcaaagttgtagaaattcgggaaattttaat
tttaatacaaacaagcccgtaacgatcggaacgggtatgacgggtatgacgacgacgacg
actcctccaatcacgaccgctcctcatccccttcgccaccaccctcacgtaagaaatttc
gaaaacgtattagaaaatttagaattgaacaatgcgagttctccaacgagaaaaactagt
cacaattttaactttaagtcgaattcgagcgatatcgataagcaacaacagaagacgatt
ttaactgcgtacggtaaaaatgaaaattcacccaaattgttaccggaaaatctgggaata
ccgtatccgggcgaagaactttcaaatcggttgacggccgtgtcacctcaaaaatccacg
aaagaaataaaatcatcgaggctttcgggaaatcaagaagacatacatttgaactgcata
ctttccactccggaacttcctccgaaaattcatttgggtaaaaaaagtccagtgtatgcc
aagggaagcggagaaacgttgtttcatttcgattcgcaaaaaatccatagaatgaatagt
tcttctcaggatggccacagttaa

DBGET integrated database retrieval system