KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM368720Help
Entry
Phum_PHUM368720   CDS       T01223                                 

Definition
tyrosine-protein phosphatase non-receptor type, putative (EC:2.7.11.14)
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 514 aa AA seqDB search
MKHQVYSCKDLNEKFIKLNKHFKIEVNKKIYISKKIVIVVLSKDNIIANNVNGFEMDAMP
KNKFLNITVLKNENFEIEPQNSQYDIVIWPSAVPLQNWRQMIQSKSKTKKIVVLDDNQIQ
LNSNSFTFPSPNSSLQDNWVGHTVININKQSSNNIDFGTVNVPGDDGVPVVLNEKKEVFE
KKVEVVKAKGLLERRGSSASLTIDLPQVMSEEFLLSAGNVLSRNDIKNCLKNVQNLHQEF
WEIPLNHPEKSLVTGCGTKNRYQSILPNEKTRVKLNKKEEFSLDAYINANYIRGYDGEEK
AYIATQGPLPNTIEDLYKMAWNEKSPIIVMITNFFEKAKVKCESYFPIEQNETAKYGDFQ
VTVLSVKRKEGFSVRELLIENNYGSKKIFHYWYDTWPDHKIPSCPQSIVDMATEIENCKK
NIKNKSLNSNDDQKNSSGPIIVHCSAGIGRTGCFIAISMAISQLLEENKVDVLGIVCQMR
CDRGGMIQTAEQYEFVHRALQLYEKSLPDSSTLD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaagtttattcatgtaaagacttgaatgaaaagtttatcaaactaaataaa
cattttaagatagaagtaaataaaaaaatttacatctcaaagaaaattgttattgtggta
ttaagcaaggataacataattgccaataatgtaaatggttttgaaatggatgccatgcca
aaaaacaaatttttgaatataacagttttgaaaaatgaaaattttgaaattgaacctcag
aatagccaatatgacatagttatttggcccagtgctgttcctttgcaaaactggaggcaa
atgattcaaagtaaaagtaaaactaaaaaaatagtggtattagatgacaatcaaatacaa
ctcaacagtaattcatttacttttccaagtccgaattcatcactgcaagataattgggtg
ggacacactgttattaatataaataaacaaagttctaataacatagactttggaacagta
aatgttcctggagatgatggagtgccagttgttttaaatgagaaaaaagaagtttttgaa
aaaaaagttgaagttgttaaagcgaaaggacttttagaaagaaggggatcaagtgctagt
cttacaattgatttacctcaagtcatgtccgaagaatttcttttatcagcgggcaacgtt
ctttcgcgaaacgatataaaaaattgtttgaaaaatgttcaaaatttacaccaagaattt
tgggaaattcctttaaatcatcctgaaaaatcattagtcacgggttgcggtaccaaaaat
agatatcagtccatattaccgaatgaaaaaacgagagttaaattaaataagaaggaagaa
ttttcactggatgcatatatcaatgcaaattacatcaggggatatgatggtgaggaaaaa
gcatacattgcgacccaaggaccactgcccaacacaattgaagatttgtacaaaatggct
tggaatgaaaaaagtcccataattgttatgataacaaatttttttgaaaaagctaaagtc
aaatgcgaatcgtacttcccgattgaacaaaacgaaactgccaaatatggtgactttcaa
gttaccgtcctgagtgtaaaaagaaaagaaggttttagcgttcgagaattattaatagag
aataattacggcagcaaaaaaatttttcattattggtatgacacgtggcccgatcacaaa
attccatcatgtcctcaaagtattgtagacatggccacagaaatagaaaattgtaaaaaa
aatattaaaaataaatcactaaatagtaacgatgaccaaaagaattcgagcggtccgatt
attgttcactgcagtgccggcataggcagaaccggatgtttcatagctatttctatggcc
attagtcaattattagaagaaaacaaagttgacgttttaggaatcgtttgtcaaatgaga
tgcgatagaggaggaatgatacaaacggctgaacaatacgaattcgtacacagagcttta
caattatacgaaaaatctctgccggattcttcaacgttagattag

DBGET integrated database retrieval system