KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM370970Help
Entry
Phum_PHUM370970   CDS       T01223                                 

Definition
Thrombospondin-3 precursor, putative
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Phum_PHUM370970
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Phum_PHUM370970
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM370970
  Exosomal proteins of colorectal cancer cells
   Phum_PHUM370970
  Exosomal proteins of bladder cancer cells
   Phum_PHUM370970
Heparan sulfate/heparin binding proteins [BR:phu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  Phum_PHUM370970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1018 aa AA seqDB search
MGLSKELEEAIRENEFVIEMKDIKPKHRIRNGLEMLLVVDFIKTDEKFVILLDRKSKKVI
IETGKDGITKSEHFSLNNNVDSKTVIKNLLFAINQESNSNESRVTLYHDCVKKGTLNISN
NFKNIFDKKKNLQLQVFREKHYFLNIEHKESLDVILDKNNCLDTEMQAQQPNSNDVAAYR
RGDIPVFHDCSDPDSLLAKTVNALIELIKQLRQDIEHQRGEIRYLRGILERCDLCARPQI
ESQIRYSCKSPSSPCFPGAECRDTPDGPQCGRCPRGYVGDGRNCKPGITCEDRPCYPGVR
CYDTIEGHQCGPCPNGYVGDGKRCNPRGICEQNPCHPGVHCTDIEEPPHYRCGSCPPGST
GNGTSCHDLDECDLAEPCDPRVRCTNLSPGFRCDPCPPGFTGSSGFQGVGLEEAARNRQR
CYDIDECSDGRNGGCAPNSICTNTEGSYVCGSCMSGYVGNQTHGCRNSPGLCPDGTQCDT
NAECYKQNRYNSYACKCKVGFAGDGRMCGLDRDLDGYPDQDLGCSDARCRQDNCISIPNS
GQEDADGDRIGDACDPDADNDGILNSPDNCPLVPNPDQLDSDMDGADKQGDACDNCPTIP
NLDQEDVDKDGIGDACDDDIDNDGIPNGRDNCPKNPNPDQRDRDRDGLGDVCDNCPLVAN
SNQFDSDNDLIGDACDSDIDRDRDGIQDSVDNCPRVPNSDQLDTDGDGRGDECDSDCDGD
GVLNQRDNCPYAYNPNQEDLDGDGIGDICQDDFDLDKVPNYLDNCPNNSKIFSTDFRTYQ
TVVLDPEGDSQIDPNWVIYNRGAEIVQTMNSDPGLAVGYDAFGGVDFEGTFFVDTEIDDD
YVGFIFSYQDNHKFYTVMWKKNTQTYWQATPFRAVAEPGIQVKLVHSGTGPGQMLRNSLW
HTGDTEDQVRLLWKDPRKIGWKEKTAYRWLLLHRPKIGLIRLRIFEGERMIVDTGNVFDS
TLKGGRLGVFSFSQEMIIWSDLVYRCNDQVPEAIYRELPPKLQREVEIDTGRPLINRS
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgagtaaagaattagaggaagccattagagaaaatgaattcgttattgaaatg
aaagatataaaaccaaaacatagaataagaaacggtttggaaatgttattagtcgttgat
tttataaaaaccgatgaaaaatttgttattttactcgatagaaaatctaaaaaggtcatt
atcgaaactggaaaagatggaataactaaaagcgaacatttttcattgaataataacgtg
gattcgaaaaccgttataaaaaatcttttatttgctataaatcaagaatcgaattcgaat
gaaagtcgtgtgactttatatcatgattgtgttaaaaaaggaactttaaacatatcaaat
aattttaaaaatatttttgataaaaaaaaaaatttacaattgcaagtctttcgagaaaaa
cattattttttaaatattgaacacaaagaaagtttggatgtcattttagataaaaataat
tgtttggatacggaaatgcaagctcaacaacccaattcgaacgatgtggcagcctacaga
agaggagatatacctgtttttcacgattgcagcgatccagatagtctccttgcaaaaact
gtcaacgctcttatcgaactcataaaacaattgagacaggatatcgaacatcagagaggt
gaaatccgctaccttcgagggattttggaaagatgcgatttatgcgcaaggccacaaata
gaatcccaaataagatattcatgtaagagtccttcgtctccctgttttcccggtgccgaa
tgtagggatactccggatggaccacaatgtggacgatgccctcgcggatacgtgggtgac
ggtagaaattgtaaaccaggtataacgtgcgaggatagaccctgttatccgggtgttcgt
tgttacgacaccatagaaggacatcaatgcggtccatgtccgaacggttatgtcggcgat
ggaaaaagatgtaatccgaggggtatatgcgaacaaaatccttgtcatccaggagttcat
tgtacggatattgaagaaccaccgcattacagatgcggaagttgtccaccgggatcaaca
ggaaatggaacttcttgtcacgatttagatgagtgcgatttggcagagccttgcgatccc
cgagtccgatgtacaaatttatcgcccggttttagatgtgacccgtgtccacccggattt
accggaagtagcggttttcaaggggtgggattagaagaagctgctagaaacaggcaaaga
tgttacgatattgacgaatgttcggacggacgaaacggtggatgcgcccctaattctatt
tgcacaaataccgaaggttcttacgtgtgcggaagttgtatgtcgggatatgtaggaaat
caaactcacggatgtcgaaattcaccgggattatgccccgacggtacgcaatgcgatacg
aatgcagaatgttataaacaaaatcgatataatagttatgcgtgcaagtgtaaagtgggt
ttcgctggagatggaagaatgtgcggtttggatagagatttggatggatatcccgatcaa
gatttaggttgttccgatgcaaggtgcagacaagataattgtatcagcattcccaattcc
ggacaagaagatgccgacggagatcgtattggtgacgcttgcgatcctgatgcagacaac
gatggaattctcaacagtcccgataattgtcctttggtacctaatccggatcagttagac
agtgatatggatggagcggataaacagggtgacgcttgcgacaattgccctaccatacct
aatttagatcaagaggatgtcgacaaggatggaataggggatgcttgcgatgacgatatt
gataacgatggtattcccaacggacgtgataattgtcccaaaaatccaaatccggatcaa
agggatagagatcgggatggattgggagatgtttgcgacaactgtcctctcgttgcaaat
tctaatcaatttgatagcgataacgatttgattggagatgcttgcgacagcgatatcgat
cgcgacagagacggtatccaagactcggtcgacaattgtcccagagtccccaacagcgat
caattagatacagatggagatggtagaggagatgaatgcgacagcgattgcgacggagat
ggcgtactaaatcaaagagataattgtccctacgcttataatccaaatcaagaagattta
gatggtgatggaataggagacatttgtcaagatgatttcgatttggataaggttccaaat
tatttagacaactgccctaataattctaaaatattttccacggatttcagaacttatcaa
actgttgttttggatccggaaggagattcacaaatagatcccaattgggttatatataat
agaggtgccgaaattgtacaaacgatgaatagtgatccaggtttagctgtaggttacgat
gcatttggtggagtcgatttcgagggtacatttttcgtagacacggaaatcgatgacgat
tacgtcggtttcatattcagttatcaagacaatcacaaattttacacggtaatgtggaaa
aaaaatactcaaacctattggcaagccacaccgtttagagccgtcgcagaacctggaatt
caagtcaaattggttcattcgggtacgggaccgggtcaaatgttgagaaattctctctgg
cacacgggagacacggaagatcaagtgcgtttgctttggaaagacccgaggaaaattggt
tggaaagaaaaaaccgcgtatcgatggcttttacttcacagacctaaaatcggtttgata
agactcagaatattcgaaggggaacgaatgattgtcgataccggaaacgttttcgattcg
actctcaaaggaggaagattgggagttttttcattttctcaagaaatgattatttggtcc
gatctcgtgtacagatgcaacgatcaagtaccggaagccatatatagagaattaccaccg
aaattacaaagagaagtggaaatagataccggaaggcctttgattaatagaagttga

DBGET integrated database retrieval system