KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM370980Help
Entry
Phum_PHUM370980   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Phum_PHUM370980
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phum_PHUM370980
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Phum_PHUM370980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 812 aa AA seqDB search
MEENNLNLPEYGFKVKLNHKFAEKWTQDLRPRLNQFWSMIPLIIRYLIYSIYILCKGRRP
LMDYMKNLNGKQMYGVPLGGIGSGSIGRGFKGEFCRYQLRPGNYEYETIYGNQFILTVRD
GEGNAVFQKVLNCGRAPKSCLKNWDWTLNGENANYVGLYPRSWTEYNIEEQKLRLICKQI
SPVIPNNYKDSCIPGSMFIWHIENQSNEVKDVNITFTFQNGIGEKGDKKKGCWSQMFKEN
CSNGNILGVLINHVISSMNYTFGISVCEKAGVHVSCLKKWNPLGNGKDIWNKIKTGKLEK
FDFDPSHHTANGEQLASAVCAQTLIPGKSVSTLEFNLIWDMPKINFHENKKQYWKYYTRF
FGKEKNGPKLSAYCFENYKNWDLEIDKWQNPILNDDNLPSWYKSALFNETYFVSDGGTVW
LDLDEDEKKLLSANDPRCEYGRFAYLEGHEYRMYNTYDVHFYASFALAMLWPNLQSCVQR
DFCDTVPQEDRSRQWHLFNGSIGYRKVKNSVPHDLGDPFEEPFLKINSYPIHDVSEWRDL
DLKFVLQSYRDYFLNNDLNQLKYLWKSVCVLMNNALRWDKDGDGLIENVGEPDQTYDAWT
MEGPSAYCGSLWLAALQCTCKMALILSDVDTYNKFSETLKMAQQSFDKKLWNGKYYNFDC
SEKWGTTIMSDQLCGLWYLYCCGIKNEVLPPAKVNSSLRCIYENNVLKLGKGNLGCVNGM
LPNGEIDIHTLQSEEIWVGVVYALASLMIFEGMVEEGWKTARGIYETVYDRIGMGFETPE
ALRESKKYRAIGYMRPLSIWSMQLAWNMRNTN
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaataatttaaatttgccagaatatggctttaaagttaaacttaatcataaa
tttgcggaaaaatggacacaagatctgcgtccccgattaaatcaattttggagtatgatt
cctcttatcataaggtatttaatttacagcatttatattttgtgcaagggtaggaggcct
ttgatggactacatgaaaaaccttaatggaaaacaaatgtatggagtgcctttaggagga
atcggttcagggtcaataggtagaggttttaaaggagaattttgtagatatcagcttaga
cctggtaattacgaatatgaaacaatttatggaaatcaatttatccttactgttagagat
ggtgaaggcaatgctgtttttcaaaaagtattaaactgtggaagagctcctaaatcatgt
ttaaaaaattgggattggactttgaatggagaaaatgcaaattatgtaggactttatcca
agatcatggacagaatataatattgaagaacagaaactcagacttatttgcaaacaaata
tctccagtcattcctaacaattacaaggatagctgtattccaggatcaatgtttatttgg
catattgaaaatcaaagtaatgaagttaaagatgtaaatataacatttacatttcaaaat
ggtattggagaaaagggagataaaaaaaaaggatgttggagtcaaatgtttaaagaaaat
tgttcgaatggaaatatattgggagttttaataaatcatgttatttcatcgatgaattat
acatttggtatctctgtttgtgaaaaagcaggagttcacgtttcttgccttaaaaaatgg
aatccattaggaaatggaaaagacatttggaataaaataaaaacagggaaattggaaaaa
tttgatttcgatccttcacatcacacagccaatggtgaacaattagcaagtgctgtttgt
gctcaaactctaatacctggaaaaagtgtttccacactcgagtttaatctgatttgggat
atgccaaaaattaattttcatgaaaataaaaagcaatattggaaatattatacgagattt
tttggaaaagaaaaaaatggacccaaactttctgcttattgttttgaaaattataaaaat
tgggatttagaaatagacaaatggcaaaatcctattttaaatgatgataatttaccctcg
tggtataaaagtgcactttttaatgaaacctatttcgtatccgatggtggcacagtttgg
ctcgatttagacgaagatgaaaaaaaacttttatcagcaaacgatcctaggtgcgaatac
ggtcgttttgcataccttgaaggtcatgagtacagaatgtacaacacttacgatgttcat
ttttacgcatcatttgctttagccatgctatggccaaatcttcaaagttgcgtacaaaga
gacttttgcgataccgtacctcaagaagatagatcacggcaatggcatttatttaacggt
agcattggatacagaaaagttaaaaattccgtaccacatgatttgggagatccatttgaa
gaacctttcttaaaaattaactcttatccaatacacgacgtttcggaatggagggattta
gatttgaaatttgttcttcaatcttacagagattattttttaaataatgatttaaatcag
ttgaagtatctttggaaaagtgtttgcgtacttatgaataatgcacttcgatgggataaa
gatggcgacggcctaattgaaaatgtcggcgaacctgatcaaacgtacgacgcgtggacc
atggaaggcccaagtgcttattgtggaagtttatggcttgcagctttacaatgcacgtgt
aaaatggctttaattctttcggacgttgacacttacaataaattttctgaaacgttaaaa
atggcgcaacaatcttttgataaaaaactatggaatggaaaatattataatttcgattgt
tctgaaaaatggggaacgacaataatgtcggatcaattatgcggtttatggtatctttat
tgctgtggaataaaaaacgaggtgttacctcccgccaaagttaactcttcacttcgttgc
atatacgaaaacaatgttttgaaattaggcaagggtaacttgggatgtgttaacggcatg
cttccaaatggtgaaatcgacattcacactcttcaaagcgaagaaatttgggtcggagtc
gtttacgcattggcttctctcatgatattcgagggaatggtagaagagggttggaaaacg
gctcgtggaatttacgaaaccgtatacgatcgcatcgggatgggtttcgagactccggaa
gctttgagggaatcaaagaaatatcgagccatcgggtacatgcgtcctttgtcaatttgg
tcgatgcagttggcgtggaatatgcgaaacacaaattaa

DBGET integrated database retrieval system