KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM372730Help
Entry
Phum_PHUM372730   CDS       T01223                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.12.2)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Module
MAPK (p38) signaling
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM372730
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Phum_PHUM372730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MSGLAMRKGKKSLKIQVPVEETNYATPPRNLDKSTTITIGDKTFVVEADDLEKMCDLGRG
AYGVVEKMKHIPSGTVMAVKRIAATVNTQEQKRLLMDLDISMRSSDCQYTVQFYGALFRE
GDVWICMEVMDTSLDKFYHKVYSYSRVIPEDILGKIAFAVVSALQYLYSKLRVIHRDVKP
SNILISRTGKVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERIDPTGNPSNYDIRSDVWS
LGISLIELATGKFPYKSWGTPFEQLKQVVTDDPPKLPQGQFSNDFDDFITKCLKKKYTDR
PNYEELLEHQFIITHRDKETDVAKFVDEILNLPDVVK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctggattagctatgcgtaaaggaaaaaagtctcttaaaattcaagttccagtggaa
gaaacaaactatgcaactccgccaaggaatcttgacaaaagtactacaattactattggt
gataaaacatttgtcgtagaagctgatgatcttgaaaaaatgtgtgatttagggagaggg
gcatatggagttgtagaaaaaatgaaacatattccaagcgggactgtaatggctgttaag
agaatagcggcaacagtgaatactcaagaacaaaagaggttattaatggatttagatatt
tcaatgagatcatctgattgccagtatactgttcaattttatggagccttatttagagaa
ggagatgtttggatatgtatggaagtgatggatacaagccttgataagttttaccacaaa
gtatacagttattcaagagtaattcctgaagatattttaggaaagattgcattcgctgtt
gttagtgctttgcaatatttatattctaagttaagggttattcatagggatgtaaaacca
tcgaatattttaattagtagaactggaaaagttaaaatgtgcgattttggaatttctggg
tacttggttgattctgttgcaaaaactattgatgcagggtgtaaaccttacatggcgcct
gaaagaatcgatccgaccggtaacccttctaattatgatattaggtcagatgtttggagt
ttaggaatttctcttatcgaattggcgacaggaaaatttccctataaatcatggggaact
ccttttgaacaattaaaacaagttgtaactgatgatccaccaaaactgcctcaaggacaa
ttttccaatgatttcgatgatttcattacaaaatgtttaaagaaaaaatatacggatcga
cccaattacgaggaacttcttgagcatcaatttataataactcatcgtgataaggaaacg
gatgttgcgaaatttgtcgacgaaatattaaatttaccggatgtggtaaaataa

DBGET integrated database retrieval system