KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM380460Help
Entry
Phum_PHUM380460   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM380460
Enzymes [BR:phu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Phum_PHUM380460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 277 aa AA seqDB search
MAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKQAIFDGKKAIRGGVPFVFP
QFGHWSFGPQHGFARITRWNLEKAPERLPSGDVEAVFSLTDNEFTRSMWNYQFRLTYRLI
LREKELHFNIGIYNPSKQLTFSFNLLLHTYFKCPDVRRCQITGLHGCPFIDKTREGAAYQ
EGRDVVTISEWTDRIYRNTPQEHIITNVVSGRKMRIQKYNFPDTVIWNPWMDQAKEIPDF
GDDEFPNMVCVESGHVSSPVILLPGTAFEASQILQVM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacgagtgttgttgtcttagataggggaaataatacaacatgtactatcaat
ttacatggtgctactgttgtatcttggcgagtaaataaccaagaacaattgttcgttagt
aaacaagcaatatttgatgggaaaaaggctatcagaggaggagtaccttttgtatttcct
caatttggacactggagtttcggacctcaacatggttttgctcgtatcacacgttggaat
ttggaaaaggctccagaaaggttaccaagcggtgacgtcgaagctgtattttcattaacg
gataatgaatttacacgttcgatgtggaattatcaatttcgattgacttataggcttatt
ttgagggaaaaagaacttcattttaatattggaatatacaatccgagtaaacaattaact
ttcagttttaatttacttttgcacacgtattttaagtgcccagacgttcgaaggtgtcaa
atcactggattacacggttgtccatttattgataaaactagagaaggagcagcgtatcag
gaaggtcgcgacgtagttactataagtgaatggacggatcgaatttataggaataccccg
caggaacatattataacaaatgtagtttctggaagaaaaatgagaatacaaaaatacaat
tttcccgacaccgtcatatggaatccatggatggatcaagcaaaagaaattccagatttc
ggagacgatgaatttccaaacatggtttgcgttgaatcgggacacgtttcgagtccggtc
attcttcttcctggaactgccttcgaggctagtcaaatattgcaagtaatgtga

DBGET integrated database retrieval system