KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM387870Help
Entry
Phum_PHUM387870   CDS       T01223                                 

Definition
Thymidine phosphorylase precursor, putative (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Phum_PHUM387870
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Phum_PHUM387870
Enzymes [BR:phu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Phum_PHUM387870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 445 aa AA seqDB search
MELSIPEIICKKRDGFELSAQEIEFFINKVVNCTINDAQTGAMLMAMYLRDLTLKETINL
TKSMINSGEILKFKNFSKDILIDKHSTGGVGDKVSLILAPALAAVGLKVPMISGRSLKFT
GGTLDKLESIPNFQVSLTPEKMNECLMEAGCFICEASRDFAPADALLYKLRDITSTVDNH
GLIVSSILSKKATEGIGELLIDVKFGSGSFSKTEEEARKLAETLINVGKAVNLNTKAVIS
EMNSPLGEYVGNTLEVIESIKCLKNEIENDLLDLVLFLGGIIIKSKGLVKSLEDGKEMLY
ETIKDGRALKHFEKMLVCQGVSQKNAIQLCSGDYWNVLSKSKYTTILKSHKKGIIEKIEP
LNIGKACWLLGGGRRTKINLPIDYSTGVIFLKTVGSNIDNNEPWIQIHHSTQILPKEIKD
LIEKSLIITVDSTKIKKKISMSLII
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagtatacctgaaataatttgtaaaaaaagagatggatttgaactttcagct
caagaaatagaattttttataaataaagtggtcaattgtacaataaatgatgcccaaaca
ggagctatgctcatggccatgtatttaagagatttaacattaaaagaaacgattaattta
actaaaagtatgatcaacagtggagaaatattaaaatttaaaaatttttcaaaagatatt
ttaatagacaaacatagcacgggaggagtaggtgataaagtcagtttgatactcgctcca
gctttagcagctgtcggtttaaaagtacccatgatatctggtcgtagtttaaaatttacc
ggtggaaccctggacaaattagagagtattccaaattttcaagtgtctctaacaccagaa
aaaatgaacgaatgtcttatggaagctggatgtttcatctgtgaagcgtctcgagatttt
gcacccgctgatgctttattatataaattaagagacataacatcaaccgttgacaatcat
ggtttaattgtgtcttcaatattatctaaaaaggctacagaaggtattggagaacttttg
attgatgttaaattcgggtctggatcattttccaaaacagaagaagaagcaagaaaatta
gctgaaactttgataaatgttggaaaagccgttaatttaaatacgaaagcggtaatttca
gaaatgaattcgccattaggcgaatacgttggaaatacattagaagttatagaatcaata
aaatgtttaaaaaacgaaatcgaaaacgatttactcgatttggttttatttttaggagga
attattatcaaatcaaaaggtttggtaaaaagtttggaagatggaaaagaaatgttatat
gaaacaatcaaagatggaagagctttaaaacattttgaaaaaatgctcgtctgtcaaggt
gtttctcaaaaaaatgcaattcaattatgttctggagattactggaacgttttatcgaaa
tctaaatataccaccatattaaaaagtcacaaaaagggtattattgaaaaaatagaacct
ttaaatattggaaaagcatgttggttattgggaggaggaagaagaacaaaaataaattta
ccaattgattattcaaccggtgtaatttttttaaaaaccgttggatctaatattgataat
aacgaaccttggatacaaattcatcattcaactcaaattttaccaaaagaaataaaagat
ttaattgaaaaaagtttaattataacggttgattcaacgaaaattaaaaaaaaaatttcc
atgtctttaattatttaa

DBGET integrated database retrieval system