KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM388700Help
Entry
Phum_PHUM388700   CDS       T01223                                 

Definition
(RefSeq) glucosylceramidase precursor, putative
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00511  Other glycan degradation
phu00600  Sphingolipid metabolism
phu01100  Metabolic pathways
phu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Phum_PHUM388700
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phum_PHUM388700
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Phum_PHUM388700
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Phum_PHUM388700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 8237528
NCBI-ProteinID: XP_002428523
VectorBase: PHUM388700
UniProt: E0VQX9
AA seq 531 aa AA seqDB search
MTCNSFIIIIFLLLFINIFEGRQTDNVECFLRDYGNDNKVCVCNATHCDVINSIPPFPSR
KFNMYVSDKNGLRFSYSRKNFARWMNPKSIKITVNSSETYQKIIGFGGSLSDAAAININS
LSEDARNHFLFSYFSNKGIEYNLLRLPIGGNDYSNRPYTLDDVDNDVSLTYFKLSHEDFN
LKIPNLLKIMNVSDKEVQIVGTAWTAPPWMKTNNDYTGIGTLKEKYYSLWSKYFIRFLEE
YDKFGLKVWGITTGYQPFTGLIPFYPLNCMGWTPLSQTHWIFQNLGPDLRNSKFNKTNII
ILDDSRFFLPWWPKLVFKNQKTKAYVNGIGVQWYWNFLFPSRLLDLTQAEFPDKFIISTE
ASFNKWKGTTSPLILGSWERAEEYAESIIEDLNHWVSGWMDSNLALDLKGGPSWAKNFAD
AAIIVNGTGNEFYKQPLFYAMGHFSKFIPKDSIRIDLKISKSVIKAIGFRTPQKNVVIII
VNKKTYDVPITILGAKKGNANFFLPKKAIITVIYRDKKNFFHKCLSKNCKN
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcaatagttttattattattatttttttattattatttataaatattttcgaa
gggagacaaacggataatgttgaatgttttttacgcgattacggtaatgataataaagtt
tgtgtgtgtaatgcaactcattgtgatgttatcaattccattccaccttttccttcacga
aaatttaacatgtacgtatctgataaaaatggtttgagattttcatacagtagaaaaaat
tttgcacgatggatgaatccaaaatccattaaaattacagtaaattccagtgaaacttat
cagaaaataattggatttggtggttcgctatcagatgcggctgcaattaatataaattca
cttagtgaagatgcaagaaatcattttttattctcatatttttcaaacaagggtatagaa
tataatttattaaggttacccatcggaggaaatgattattcaaacagaccatatactttg
gatgatgtagataatgatgtatcattaacttattttaaactttctcatgaagatttcaac
ttgaagattcccaatttgttaaaaataatgaatgtgagcgataaagaagttcaaatagtg
ggtactgcttggacggctccaccatggatgaaaacaaataacgattacacaggaattggt
actctaaaagaaaaatattactcattgtggagtaaatattttattagatttttagaagaa
tatgataaattcggtttaaaagtttggggaatcactaccggttatcaaccttttactggt
ctcataccattttatcctcttaattgcatgggttggactccactttcgcaaactcactgg
atttttcaaaatttaggacctgatcttagaaattctaaatttaataaaacaaatattatc
attttggatgattctagattttttttaccctggtggccaaaattagtgtttaaaaatcaa
aaaacaaaagcttacgtgaatggaatcggtgttcaatggtactggaatttcttatttcca
tctcgtttattagatttaacacaagctgaatttccagataaatttatcataagcacagaa
gcttcttttaataaatggaaaggcacaacttctccattgattttaggttcctgggaaaga
gcagaagaatatgctgaaagtattattgaagatttaaatcattgggtatctggttggatg
gattcaaatttagcattagatttaaaaggtggaccgagttgggctaaaaattttgcagat
gctgctattattgtcaatggtactggaaatgaattttataaacagccattgttctatgca
atgggtcatttttcaaaatttataccaaaagattcgattagaattgatttaaaaatatct
aaatctgtaataaaagcgattggatttcgaacaccacagaaaaatgtagttatcattatt
gttaacaagaaaacttatgatgttccgataacaattttaggagctaaaaagggtaatgca
aattttttcttaccaaaaaaagctataataactgtaatttacagggataaaaaaaatttt
tttcataaatgtttgtcgaaaaattgtaaaaattaa

DBGET integrated database retrieval system