KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM397390Help
Entry
Phum_PHUM397390   CDS       T01223                                 

Definition
Ribonuclease P protein subunit p20, putative (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM397390
   03008 Ribosome biogenesis in eukaryotes
    Phum_PHUM397390
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Phum_PHUM397390
Ribosome biogenesis [BR:phu03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Phum_PHUM397390
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Phum_PHUM397390
Mitochondrial biogenesis [BR:phu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Phum_PHUM397390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 138 aa AA seqDB search
MMESCQVKKSKIKSKPKNSVYNNHQFRKRAPPKLPKRENDIYVNNSTHLQCQITKCHKLF
QEGFSEIVIHGLGAAVNTAINIALILQEKLSHTVDLAVNTSTVEIIDDYQPINDNEKSFS
KSRSNSAVHVRVYRKHNF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaagttgtcaagttaaaaaatctaaaattaaatcaaagcctaaaaattcagta
tataataatcatcaatttagaaaaagagctcctcctaaacttccaaaacgtgaaaacgat
atttacgttaacaattccactcatcttcagtgtcaaataacaaagtgtcataaactcttt
caagaaggtttttccgaaattgttattcacggtttaggagctgcagtgaacactgccatt
aacatcgcattaattttacaagaaaaactttcacacactgtagatttagctgtaaacaca
tcgacggtggaaattattgacgattatcaaccgattaacgataatgaaaaatccttttct
aaatccagatcgaattctgccgttcatgtgagagtttatagaaaacataatttttaa

DBGET integrated database retrieval system