KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM400340Help
Entry
Phum_PHUM400340   CDS       T01223                                 

Definition
Tropomyosin-2, putative
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAMDRAQMCEQQAKDANLRAEKAEEEARSLQKKIQTIENELDQT
QEQLMQVNAKLEEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA
DESERQRKILENRSLQDEERMDALENQLKEARFLAEDSDKKYDEVARKLAMVEADLERAE
ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKQQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDDLVQEKERNKLLQEEMEATLHDIQNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaaaatgcaagctatgaagcttgaaaaggataatgccatggat
agggcacaaatgtgcgaacaacaagccaaagatgccaacttgagagccgaaaaggcagaa
gaagaagcaagatcacttcaaaagaaaattcaaacgattgaaaacgaattggatcaaact
caagaacaattgatgcaagtcaatgctaagctcgaagaaaaagacaaagctttgcaaaac
gctgagagtgaagttgccgccctcaatcgtcgtattcaattgttggaagaagatcttgaa
agatccgaagaacgtcttgcaacggccactgctaagctcgctgaagcttcccaggctgcc
gatgaatctgaaaggcaaaggaaaatattggaaaataggagtttgcaagatgaagagcga
atggacgcattggaaaatcaattaaaagaagccaggtttttggccgaagattcggacaaa
aaatacgatgaggtcgctcgtaaattagccatggtcgaagcagatttggaaagagccgaa
gaaagagccgaaagtggcgaatcgaaaatcgtcgaacttgaagaagaacttcgcgttgtc
ggcaacaatttgaaatctctcgaagtgtctgaagaaaaggccaatcaacgtgaagaagaa
tacaagcaacaaatcaagaccttaacaactcgtttgaaggaggctgaagcgagagccgaa
ttcgctgaaagatcggtacagaaattacagaaggaagtcgataggctggaagatgatctt
gttcaagagaaagagagaaacaaacttctccaggaggaaatggaagccacactccacgac
attcaaaatatgtag

DBGET integrated database retrieval system