KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM407140Help
Entry
Phum_PHUM407140   CDS       T01223                                 

Definition
protein disulfide isomerase, putative (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:phu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 428 aa AA seqDB search
MRIFISLLSAAVGLYPSSSNVVSLTASNFDSLVDRGDAVWVVEFFAPWCGHCKALVPEYW
KAAAALKGVVKVGAVNCDEEPALKGRFGIQGFPTIKIFGADKKNPTDYNGARTTQAIVES
ALEAAKKKVYSNLPGKKSGGSGKSSDSKDVVQLTDDNFASNVFNSKDYWLVEFYSPGCIH
CQRLAPEWAEAATQLKGKAKLGAMDATSQSVIPSQFDITGFPTIYWFEPGAKSKKDAKPY
EGGRSSSDIVNWVVDNILENAPPPEVVELLDENVFKEQCTKNSLCIVAVLPHILDCQSEC
RNNYLKMLSKVADKFKRKLWGWTWVEAGAQMDLEQTLGMGNFGYPAMSVLNTKKQISSLF
KGSFSEEGINEFLRDLSYGRGQTSVLQNAKLPKISKIEPWNGEDQALPEEEEDIDLSDIV
LDDLKEEL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttcattagtttgctctctgctgctgtaggattatatccttcaagttcaaat
gttgttagtctgactgcatctaattttgacagtttagtagataggggtgatgctgtttgg
gttgttgaattttttgcaccttggtgcggacattgtaaagcactagtaccagaatactgg
aaagcagcagctgctttaaaaggtgttgttaaagtaggtgctgttaattgcgatgaggaa
ccagctttgaaaggaaggtttggtattcaaggttttcccacgattaaaatatttggtgca
gataaaaaaaacccaactgattataatggagccagaaccactcaggctattgtagaaagt
gctttagaagctgctaaaaaaaaagtatacagtaatctacctggcaaaaagtcaggtgga
tctggaaaaagctcagattccaaagatgtcgtacaattaacagatgacaattttgcatcg
aatgttttcaattctaaagattactggttggttgaattttactctccaggatgtatacac
tgtcaaagactggcaccagaatgggctgaagcagctacacaactcaaaggaaaagcaaaa
ttgggtgctatggatgctacatctcaatcagtgattccatctcaatttgacataacaggt
tttcctacgatatattggtttgaacctggagctaaaagtaaaaaagatgcaaaaccatat
gaaggaggaagatcttcttcagatattgttaactgggttgttgacaacattctcgagaat
gctcctcctccagaagttgtcgagttattggatgaaaatgtttttaaagaacaatgtaca
aagaattcattgtgtattgtcgcagttcttccacacattctcgattgtcaatcggagtgt
agaaataactacttaaaaatgttatcaaaggttgctgataaatttaaaagaaaattatgg
ggttggacttgggtcgaagctggtgcccaaatggatttggaacaaacattaggaatgggt
aatttcggttatcctgccatgtcagttctcaataccaaaaaacaaatttcatcattattt
aagggttcattttctgaagaaggaatcaatgaatttttaagggatttaagttatggtcga
ggtcaaacttcagttttacaaaatgcaaaacttccaaaaatatctaaaattgaaccatgg
aatggagaagatcaagctcttccagaagaagaagaagatatagatttatcagatatagtt
ttagatgatcttaaggaagagctttaa

DBGET integrated database retrieval system