KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM413460Help
Entry
Phum_PHUM413460   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM413460
   04068 FoxO signaling pathway
    Phum_PHUM413460
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Phum_PHUM413460
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM413460
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Phum_PHUM413460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 400 aa AA seqDB search
MSKNKLNLTLPPGSVGNSINSSGVHQTDQNNPFDQQHFLNKKSPLVNKTSIEVLQEQLEE
LGMDDTQRKRMEFFLCQKEKIGELSDDDFEKLGDLGSGNGGVVVKVRHLSSGLIMARKLI
HLEVKPAIKKQIIRELKVLHECNFAHIVGFYGAFYSDGEISICMEYMDGGSLDLILKKAG
RIPEDILGKITSAVLKGLSYLRDKHAIMHRDVKPSNILVNSGGEIKICDFGVSGQLIDSM
ANSFVGTRSYMSPERLQGTYYSVQSDIWSLGLSLVEMAIGMYPIPPPDAKTLAAIFGPKK
NDEDSSHSPTNGPKPMAIFELLDYIVNEPPPKLPSGIFSNEFKNFVDRCLKKNPAERADL
KTLMNHEWMKITDMKTVDIAGWVCRTMDLCPTSPTKTNQT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaataaattaaatttaacgttaccacccggctccgtaggaaattctataaat
tcatccggagttcatcaaacggatcaaaataatccttttgatcagcaacattttctaaat
aaaaagagtccattagttaataaaactagtatagaagttcttcaggaacaattagaagaa
ttaggaatggatgacacacagagaaaacgaatggaattttttttatgtcaaaaagaaaaa
attggcgaattgtcagatgatgattttgaaaaattaggagatttaggttcgggaaatggc
ggagttgttgttaaagttaggcatctatctagtggactgattatggcgagaaaattaata
catttagaagttaaacctgctattaaaaagcagataattagagaattaaaagttttacac
gagtgcaattttgctcatattgtaggtttttatggagctttttatagtgatggtgaaatt
agcatttgcatggaatacatggatggtggttctttggatttaatattaaaaaaagctgga
agaattcctgaagatattctgggaaaaattacaagtgcagtattaaaaggacttagttac
ctaagagataagcatgctatcatgcatagagatgttaaacctagtaatattttggtcaat
agcgggggagaaataaaaatatgtgattttggagtttctggtcaattaattgattcaatg
gcaaattcatttgtcggtacaagaagttatatgtctcctgaaagattgcaaggaacctat
tattctgttcaaagtgatatatggtcattagggttatcattagttgaaatggctattgga
atgtaccctataccaccaccggatgccaaaacattagcagccatttttggacctaaaaaa
aatgacgaagactcatctcattctcccacaaatggtccgaaaccaatggcgattttcgaa
cttcttgattacatagttaatgaacctcctccaaaacttccatctggaattttttcaaac
gaatttaaaaatttcgtcgatagatgtttaaaaaaaaatccggcggaaagagccgattta
aaaacgttaatgaatcacgaatggatgaaaataacggatatgaaaacggttgatattgcc
ggatgggtttgcagaactatggatttatgtccaacgagtccaacgaaaacaaatcaaact
taa

DBGET integrated database retrieval system