KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM414830Help
Entry
Phum_PHUM414830   CDS       T01223                                 

Definition
phospholipid hydroperoxide glutathione peroxidase, putative (EC:1.11.1.12)
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 172 aa AA seqDB search
MCFKFQSSDDWKSAQSVYDFTVNDSSGNPVSLEKYKGHVLLIVNVASRCGLTATNYKELV
ELHDKFHDSKGLRILAFPCNQFGGQEPGTDEEIVCFAKKKNAHFDFFSKIKVNGDDASPL
WKYLKKEQGGTLGDAIKWNFTKFIVDRNGKVVERHGPTTEPSKLVSSLEKYW
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttaaatttcagagttctgacgattggaaatcagctcaatcagtatacgacttc
accgtaaatgattcatcgggaaatccagtttcattggaaaagtacaaaggtcacgttcta
ttaattgttaacgttgcttcaagatgtggtttgactgcaaccaattataaagaactcgtt
gaactccatgataaatttcacgattcgaaaggattgagaatattggctttcccttgcaat
caattcggtggacaagaaccgggaaccgatgaagaaattgtttgctttgcgaaaaagaaa
aatgctcattttgattttttcagtaagataaaagttaacggagacgatgcttcgcccctt
tggaaatatttgaaaaaagaacaagggggtaccttgggagatgcgattaagtggaatttc
acaaagttcatcgttgacagaaatggaaaagttgtcgaaagacatggaccgactaccgaa
ccttcgaaattagtatcatcattagaaaaatattggtaa

DBGET integrated database retrieval system