KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM420280Help
Entry
Phum_PHUM420280   CDS       T01223                                 

Definition
inositol monophosphatase family domain containing protein (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Phum_PHUM420280
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Phum_PHUM420280
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Phum_PHUM420280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 307 aa AA seqDB search
MAQNTPLLLRLVASSISAANHAGKIIRDVMSHGDLAIVEKGKNDLQTEADRSAQKCIIAS
LSKQFPSVHIIGEEGAINDDVPNEWITKEADKNVLELDCPRELSNISDSDVVLWVDPLDG
TSEYTQGLLDHVTVLIGIAVGNEAVGGVIHQPYFNYKEDDKELGRTIWGIRGIGVGGFTP
KSPPANQRIITTTRSHSNNVVNEAVDAMEPTDVVRVGGAGHKVMLLMEGKAHAYVFASNG
SKRWDTCAPEAILRALGGELTDMAGNHYSYNKDTPHANTKGVLGTANKNDHEWYLKKVPK
SVLSALS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaatactcctttgttattaagattggtggcttcttcaataagtgcagctaat
catgctggtaaaataataagagatgttatgtcacacggagatttagccattgttgaaaag
gggaaaaatgatttacaaacagaagcagatagatcagctcaaaaatgcataatagcatca
ttgtcaaagcagtttcccagtgttcatataatcggagaagaaggtgccatcaatgatgat
gtacccaacgaatggattacaaaagaagctgataaaaacgttttggaacttgattgccct
cgagaactttcaaacatatctgattctgatgtagttttatgggtagatccattggatggt
acatctgaatatacccaaggacttttagatcatgttactgttttaattggaatagctgtt
ggaaatgaagctgtcggtggagttattcatcaaccttattttaattacaaagaagatgat
aaagaattgggtagaacaatttggggtattcgaggaatcggtgttggaggatttacaccg
aaaagtccacctgctaatcagagaattattactaccacaaggtctcattctaataatgta
gtaaatgaagctgttgatgctatggaacctactgatgtagttagagtcggaggagctgga
cataaggttatgttattaatggaaggtaaagcacatgcttacgtttttgccagtaatggc
agtaaaagatgggatacatgtgctccagaagctattttaagggctttgggaggtgaactc
actgatatggctggaaatcattattcttacaacaaagatactcctcatgctaatacaaaa
ggtgtattagggacagccaataaaaatgatcatgaatggtatttgaaaaaagttccaaaa
tcagtactttctgctttgagctaa

DBGET integrated database retrieval system