KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM426300Help
Entry
Phum_PHUM426300   CDS       T01223                                 

Definition
Circadian locomoter output cycles protein kaput, putative
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Phum_PHUM426300
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM426300
Transcription factors [BR:phu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Phum_PHUM426300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 660 aa AA seqDB search
MDDDTDDKDDTKRRSRNLSEKKRRDQFNMLINELSSMVSTNNRKMDKSTVLKSTIAFLES
HNELAVRSRAHEIQEDWKPSFLSNEEFAHLILEAVEGFIIAFSTCGTIIYVSGSITSLLG
YLPGELMKPSVTIFDILYEEDQPNIYNILSNSEHGFGSNIGKENQMEFSCHLRRGVDDYR
DEPVYQLVHFVGYFKTDSSKTDVDNMVSSTNRYTGDGESSLMFVGTGRLDTPQLIREMTI
SDNLKSEFTSRHNLDWKFLALDSRATPIIGYVQLEVVGTSGYDYYHIDDLDKIVVCHETL
MEKGEGTSCYYRFLTKGQQWIWLQTRFYISYHQWNSKPEFIVCTHRVVSYVDVMNEFKKY
PCDDNTSDSKANTNDSTSKSKRKSCSLDQVASSPWSSKSSVGPVPQIEVSSPTSATKSQR
KRYQGPGSDSASMASADSPGSRHSQLTTLTAHSQRVQNTSKKSLSMTKLPVLSPAQASTT
FIESQHQYAVAAIPLQPIIGFPGTAVVTSIPTQELLCHPQAQLSDHVKRKQHELNQLRQL
MYRKEEELQQCLLVQGRCGIVSVPSYTVSGECSGTNQSTNQSGPDLYVTSHSIVASPLTV
TTISPSDIRLQPANSSSESHSGGIYNDQHSQSDSELIPFQFSQQQAQFLFTNISPPPNSH
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgacacggatgataaggatgatactaaaaggagatctagaaacttgagcgag
aaaaaaagaagagatcaatttaacatgcttatcaatgaattaagttcaatggtgtctacg
aataatagaaaaatggataaatcgacagttttgaaatcgactatagcatttctcgaaagt
cacaatgaattggctgtcagatcgagagctcatgaaattcaagaagattggaaaccatct
tttttatccaacgaagaatttgcacatttgatactagaagctgtcgaaggtttcataatc
gctttttcaacctgtggaacaattatttatgtttccggaagcataacatcacttttagga
tatttgcctggagagttgatgaaaccttctgttaccatttttgatattttgtacgaagag
gatcaacccaacatttacaacatcctatcgaattcggaacacggtttcggttcgaatatt
ggaaaagaaaatcaaatggaattttcgtgtcatttgcgacgaggtgtagacgattatcgc
gacgaacccgtttaccaattggtacattttgtcggttattttaaaactgattcgagtaaa
accgatgtggataacatggtatcgagtacgaatcgatataccggagatggagaatcgtct
ttgatgttcgtcggaaccggtcgtttggatacacctcaattaatcagggaaatgacaata
agtgataatttaaaaagtgaattcacgtcacgtcacaatttagattggaaatttctcgca
ttggattcgagagcgacgcccattatcggttacgtacaattagaagtcgtcggtacttcc
ggttatgattattatcacatcgacgatttggataaaattgtcgtttgtcacgaaacactg
atggaaaagggtgaaggaacttcctgttactatcgttttctaacaaaaggtcaacagtgg
atttggcttcagacgcgattttacatatcgtatcatcagtggaattcgaaacctgaattc
atagtgtgcactcatcgtgttgtcagttacgttgacgtcatgaatgaatttaaaaagtat
ccgtgcgatgataatacgagcgattcaaaagctaataccaacgattccacgtcgaaatcg
aaaaggaaatcttgcagtctcgatcaagttgcatcgtcgccatggtcgtcgaaatcatcc
gtcggacccgtgccacaaatagaagtatcatctcccacttccgcaacgaaatctcagcgt
aagagatatcagggacccggaagtgattcggcatccatggcgtctgcagattctcccggt
tccagacattcccaacttacgactttgaccgcacacagtcaaagagtgcaaaatacttcg
aaaaaatctctttccatgacaaaacttcccgtgttatcccctgcccaagcttcgaccacg
ttcatcgaatctcaacatcagtacgctgttgctgccattcctttacaaccgataattggc
ttcccgggaactgctgtcgtcacttcgattccaacacaagaattgttgtgtcatcctcaa
gcgcaactttccgatcacgtgaaaagaaaacaacacgaattaaatcaattacgtcaattg
atgtacaggaaggaagaagaacttcaacagtgtcttttggtacagggaagatgcggaatc
gtgagcgtaccttcttataccgtgtccggagaatgttcgggaacgaatcaatccactaat
caatccggtcctgatttgtacgtgacgtcacattccatagtcgcatctcctctcacggtg
acgacgatatctccgtcggatatacgactacaacctgccaattcgtcatcggaatctcat
tcgggtggaatttacaacgatcaacattcgcaatcggattcggaattgattccttttcaa
ttttcacaacagcaagctcagtttcttttcacgaacatttcgccgccgccgaatagtcat
taa

DBGET integrated database retrieval system