KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM428980Help
Entry
Phum_PHUM428980   CDS       T01223                                 

Definition
eukaryotic translation initiation factor 3 subunit, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Phum_PHUM428980
Translation factors [BR:phu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Phum_PHUM428980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 611 aa AA seqDB search
DESNFSDPEGFVDDITDEELLGDFLKNKPTETDGVESVIVVDGIPQVGPDRFEKLIGVIN
KIFSKMGTIVNEYYPKTEAGVTKGYVFIEYSSPLHALEAVKLTNNHKLDKQHTFLVNLFT
DFKKCEEISENWEPPAPSKYKEQGNLHYYLLDPDAYDQFVVTIGNGQALQIWLNTAPEPT
KIEERNRWTETYCKWSPLGSYLATFHRKGLALWGGPTFEQVQRFSHMNVQFIDFSPCEKY
LVTYSPPSPELNSEQKALIIWDIRTGVEQRSFPMESGQNLWPIFRWSYNDQYFARIVGDV
LSVYTTPTFGLLDKRSFKIPGIRDFSWSPSDNVLAYWVAENKDVPARVTLLEIPSRNEIR
PKNLFNVADCKIHWQKSGDYLCVKVDRYSKVKKEKNDVKYSGMYYNFEIFHMRGKQIPVD
SVEIKETIHAFAWEPVGNKFAIIHGDAPNINVSFYGVKTGQAPTLLKRFEKRNCNHLFWA
PIGQFIVLAGLRNNMSGVLEFIDTNDFTSMNVTDHYQCSDVEWDPTGRYVVTAISLWKTK
VDTGYRIWSFQGKLLKLVYLDNFCQFLWRPRPPTLLSVEKQKEIKKTLKKYSAQFEMVFL
HGNVEKKVFPF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gacgaatccaattttagtgatcccgagggatttgttgacgacattactgacgaagagtta
ttaggtgattttctgaagaataaacctactgaaacagatggagtcgaatctgttattgtg
gtggatggcattccacaagtggggccagatcgatttgaaaaacttataggtgtcattaat
aaaattttttccaaaatgggaactattgttaatgaatactatcctaaaactgaagcaggt
gtaacaaaaggttatgtatttattgagtactcttctcctctacatgccttggaagcagtc
aagttaacaaataatcataaattagataagcagcacacatttttagtaaatttatttact
gattttaaaaaatgcgaagaaatttctgaaaattgggaaccccctgcacctagtaaatat
aaagaacagggaaatttacattactatcttttggatccagatgcttatgatcagtttgtc
gtaacaattggtaatgggcaagcgttacaaatatggctgaatactgctccggaaccgact
aaaatcgaggaaagaaatagatggactgaaacttattgcaagtggtctccattgggttct
tatttggcaacttttcatcgaaagggattggctttgtggggaggaccaacatttgaacaa
gttcaaaggtttagccacatgaacgttcaatttattgacttttccccgtgtgaaaaatat
ttagtaacatattcaccaccgtcccctgaattaaattctgagcaaaaggctttaattatt
tgggacatcagaaccggggtggagcaacgatcttttccaatggaaagcggtcaaaattta
tggcctatatttaggtggtcttataacgaccagtattttgcaagaatcgttggtgatgtt
ctcagtgtttacactacaccgacttttggtttattagacaaaagaagtttcaaaattccc
ggtataagagattttagttggtcaccatcagataatgtattagcttattgggtggcggaa
aataaagatgtacccgcgagggtaacgcttttggaaattccaagccgtaatgaaatacga
cctaaaaatttatttaacgttgccgattgtaaaatacattggcaaaaatctggtgactac
ctttgcgttaaagtcgataggtattcgaaagtgaaaaaggaaaagaacgatgtgaagtac
agcggcatgtattacaattttgaaatttttcacatgagaggaaagcaaattccggttgac
agcgtagaaataaaagaaacaatacatgcatttgcttgggaacccgtcggtaataaattt
gccatcatacacggggatgcacccaacattaatgtcagtttttacggcgttaaaacgggt
caggctcctactttattgaagagatttgaaaaaagaaattgcaatcatttgttttgggca
cccattggacaatttatagttttagcaggacttcgaaataacatgtccggagttcttgaa
ttcatagacacaaatgattttacgtccatgaacgtgacggatcattaccagtgttctgac
gtggaatgggatccgactggtagatacgttgtcacggcaatttccctttggaaaacaaag
gtcgataccggatatagaatatggtcttttcaaggcaaacttttaaaattagtttacttg
gacaacttttgccaattcttgtggcgaccgagacctccgacacttctcagcgttgaaaaa
caaaaggaaataaagaaaacgttgaagaaatactctgcgcaattcgagatggttttctta
catggaaatgttgagaaaaaagtttttcctttttaa

DBGET integrated database retrieval system