KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM430820Help
Entry
Phum_PHUM430820   CDS       T01223                                 

Definition
purine biosynthesis protein 6, pur6, putative (EC:4.1.1.21 6.3.2.6)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM430820
Enzymes [BR:phu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Phum_PHUM430820
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Phum_PHUM430820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MSSKKIANYAVGKKIIEGKTKIVWELVEHPNLCLLESKDRITAGDGVKAHDLEGKAEISN
ATNAKVFEILNSVGLKTAFVKPAGPTAFISKKCEMVPIEWVTRRLATGSFLKRRPGVPEG
FRFNPPLQETFFKDDANHDPQWTEEQIVSAKFKVNGLVIGQDEVDIMRRTTVVVFEILEK
AWNTRDCALIDMKIEFGVDSEGNILVADVIDSDSWRLWPSGDKRLMKDKQVYRNLTTVTQ
EDLNTVKNNFKWISNQLEHLTPPTNSLVVILMGSPSDSDHCMKIAEHCQKLGVPAQLRVT
SAHKGTSSTLNVVAQYEVVFVAVAGRSNGLGPVLSGNTSYPVINCPPVKPDNVTQDIWSS
VNVPSGLGCTTVLYPEAAALAAAQIHSLHDYIIWSKLRVKQLNNHNSLSLADKAMRNTVL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgaaaaaaattgcaaattacgcggttggaaaaaagataatcgaaggtaaaacg
aaaattgtttgggaacttgtcgaacatccaaatttatgccttttggaaagtaaagacaga
ataactgccggagatggagttaaagctcacgatttagaaggaaaagctgaaatttcaaat
gctacaaatgctaaagtttttgaaatattaaattctgtcggacttaaaacagctttcgtt
aaaccagccggtccaaccgcttttatttcgaaaaaatgtgaaatggtaccgatagaatgg
gttactagaaggcttgcaaccggaagttttcttaaaagaaggcctggagtaccggagggt
ttccggtttaatcctcctttgcaagaaactttttttaaggacgacgcaaatcacgatcca
caatggacggaagaacaaattgtatccgcgaaatttaaagttaacggtcttgtaatcggt
caagatgaagttgacattatgagacgtactactgttgtagtatttgaaattcttgaaaaa
gcatggaatacgagagattgtgcattgattgatatgaaaattgaatttggagtcgattct
gaaggaaacatccttgttgctgatgtcatcgatagtgactcttggcgtctttggccatca
ggagacaaaagattgatgaaagataaacaagtttacagaaatttaacgaccgttactcaa
gaggatttaaatacagtaaaaaataatttcaaatggatttcaaatcaacttgaacacttg
acgcccccaaccaattcattggtcgtaattttaatgggatctccatctgattctgatcat
tgtatgaaaattgcagaacattgtcaaaaattgggtgtgccagcacaattgagagtgact
tcagcacacaaaggaacatcgtcaacattgaatgttgtcgctcaatatgaagtagttttt
gttgctgtcgctggaagaagtaatggtttgggacctgtgttgtctggaaatactagctac
cccgtcataaattgtcctcctgttaaaccggacaatgttacccaagatatatggtcatct
gtaaatgtgccatcaggtttgggctgcactacagttctttatccagaagctgccgcactt
gcagctgctcaaattcattcacttcacgattatataatttggtcaaaactcagagttaaa
caattaaacaaccacaacagtttgagtttggctgacaaagcaatgagaaacacagtttta
taa

DBGET integrated database retrieval system