KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM432180Help
Entry
Phum_PHUM432180   CDS       T01223                                 

Definition
unc-13, putative
Orthology
K15293  
protein unc-13
Organism
phu  Pediculus humanus corporis (human body louse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1030 aa AA seqDB search
MAATKRNAGLTSAVPRATLNDEELKMHVYKKTLQALIYPISSTTPHNFLLWTATSPTYCY
ECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMK
ERMKQREREKPEIFELIRSVFGVDEKSHIGYMAAVKQSVLDGTSKWSAKIAITVICAQGL
IAKDKSGTSDPYVTVQVGKVKKRTRTMPQELNPVWNEKFYFECHNSSDRIKVRVWDEDND
LKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKG
EEKVAPYHVQYTCLHENLFHSLCENNGGMVNLPRAKGDDAWKVYFDEAGEELVDEFAMRY
GIESIYQAMTHFHCLSTKYLCPGVPAVMSTLLANINAFYAHTTASSAVSASDRFSASNFG
KEKFVKLLDQLHNSLRIDLSMYRNNFPASSQEKLMDLKSTVDLLTSITFFRMKVQELSSP
PRASTVVKDCVKACLRSTYQFLFENCYELYSREFQVDPSEPKRDPNDNGPQLDSVDFWHK
LIALIVSVIEEDKNSYGPVLNQFPQELNIGQLSAATMWSQFAIDMKYALEEHETHRLCKS
SAYMNLHFKVKWLHTNYVKDVPPYKGTVPEYPAWFEPFVMQWLNENDDVSLEYLHGAFNR
DKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMKRFAKTIVKVLV
AYADICKKEFPNFLKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQN
LNSVLDDLAIVFASSLENQITVSVRELGDLLLSIKGGGQVTLNQPAQRNAVAQEADEVLR
PLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTVVLPPMTDKTMILKNLTDNA
KNLAANAKIEDMSKLFRNHMAGKQDVKNALSGVMDISKEVERNLTPKQCAVLDVALDTIK
QYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQTTDALIKTFVTTQLNEEKKKNYRQNVL
FSRYRSIFPV
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacaaaaagaaatgctggacttacatcggctgtgccaagagcgacactcaac
gatgaagaattgaaaatgcacgtgtataagaaaacccttcaagctcttatctatccgata
tcaagcacgactcctcacaattttctactttggactgcgacgtcaccaacgtattgttac
gaatgcgaaggtttgctatggggaatagcgagacaaggagtcagatgtacggaatgcggg
gtcaaatgtcacgaaaaatgtaaagatttattaaacgcggattgtttacaacgtgcggcg
gaaaaaagttcaaaacacggagcagaagacaaagcaaacagcataataacggcaatgaaa
gaaagaatgaaacagcgggaaagagaaaaacctgaaatattcgaactcatcaggtccgtt
tttggagttgacgaaaaaagtcacatcgggtatatggcggctgtgaaacaaagcgttctc
gatggtacatcaaaatggtcggctaaaatagcaatcacagttatatgtgcccagggtctt
attgccaaagataaaagcggaacatccgatccatacgtgacggtacaagttggaaaagtt
aaaaaaagaacgagaacgatgccgcaagaattaaatccggtttggaacgagaaattttac
ttcgagtgtcacaattcgtcggataggataaaagtaagagtttgggacgaagataacgat
ttgaaatcgaaattacgacagaaattaacgagagaatccgatgattttttgggtcaaacg
ataatcgaagtgagaacattatccggtgaaatggacgtttggtacaatctggaaaaaaga
acggataaatcagccgtttccggtgctataagattacatatcagcgtagaaataaaaggt
gaagaaaaggtcgcgccatatcacgttcaatacacttgccttcacgaaaacctttttcat
tctctctgtgaaaacaacggaggaatggttaatttaccgagagccaagggagacgatgct
tggaaagtttatttcgacgaagctggagaagaattagtcgatgaatttgccatgagatac
ggcatcgaatccatatatcaagctatgacgcattttcattgcctttcgacaaaatattta
tgccctggagtacctgccgttatgagcactctcttggctaatataaatgccttttacgcg
cacactacagcatcatcagctgtatctgctagtgatagattttcagcctctaattttgga
aaagaaaaatttgttaaactcttagatcaattgcacaattcattgagaatagatttatca
atgtataggaataattttccagcgtcgagccaggaaaaattgatggatttaaaatcaacg
gtagatttattaactagtataactttctttagaatgaaagtacaagaactttcgagtcct
ccgagagcgtcgacggtcgtaaaagactgcgttaaagcgtgtttgagatcgacatatcaa
tttttattcgaaaattgttacgaactttattcgcgtgaatttcaagtggatccgagcgaa
cccaaaagggatccaaacgataacggaccgcaattggacagcgttgatttttggcacaag
ttaattgcactgatagtatccgtcatcgaagaagataaaaacagttacggtcctgtattg
aatcaatttccacaagagttgaacataggtcagttgagtgctgcgacgatgtggagtcaa
tttgccattgatatgaaatacgctctcgaagaacacgaaactcacaggctgtgcaagtct
tctgcttacatgaacctacatttcaaagtcaaatggttacatacaaattatgtaaaagat
gtgcctccatataaaggaaccgtgccggaatatccagcatggtttgagcccttcgtcatg
cagtggttaaatgaaaacgatgacgtttcgttagaatatttacacggggcctttaacaga
gataaaaaagacgggtttcaaaaaagtagtgaacacgcattattttccaattccgtcgtg
gatgtgtttactcagctcactcagtgctttgatgtcgtttctaaattagaatgtccagat
cccgaaatatggaaaagatacatgaaaagatttgctaaaacaatcgttaaagtattagtt
gcctatgccgacatatgtaaaaaagaatttccaaattttttaaaagacgaacgtattgcc
tgtattttaatgaacaacattcaacagttgagagttcaattggaaaaaatgtttgaatca
atgggcggtgataaattggaagaagatgctgccaacatattaaaagagctacagcaaaat
ttaaacagcgtactcgatgatctcgcaatagtgtttgcatcgagtttggaaaatcaaata
actgtcagcgttcgagaattaggagatttattattgtccataaagggcggaggacaagtc
acgttaaatcaacccgctcaaaggaatgctgttgcacaggaagcggatgaagttcttcgt
cctctcatggatttactcgacggttcgctcacactttacgctcagtcgtgtgaaaagact
gtgttaaaacgcttgctcaaagagctctggaaaatcgtcatgagaattctggagaagact
gttgttttacccccaatgactgataaaacgatgattcttaagaatttaacagacaatgct
aaaaacttggcagccaatgcaaaaatagaagacatgtcgaaattgtttaggaatcacatg
gcaggaaaacaagacgttaaaaatgcattaagcggcgttatggatatatcgaaagaagta
gaaaggaatttgacaccgaaacagtgtgccgttttagacgtggcactagacacgataaaa
caatatttccacgccggcggaaacggtttgaaaaagacatttttggaaaaatcaccggaa
ttgcaaagtttgagatatgccttgtctttatacactcaaacgactgacgccctgataaaa
acgttcgtcacgacgcaattgaacgaagaaaaaaaaaaaaattatcgacaaaatgttttg
ttttcgagatatcgatcgatatttcccgtatga

DBGET integrated database retrieval system