KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM433670Help
Entry
Phum_PHUM433670   CDS       T01223                                 

Definition
set domain protein, putative (EC:2.1.1.43)
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM433670
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Phum_PHUM433670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2269 aa AA seqDB search
MDNVHITHIDGEPPIYREMKAVSVSLDQCILNSEEDYQYNEGEESLMCKDYVDGDLSAEE
INSMIMINEGPNALEYLSTKSLQKLSGPNKKLGKNKVRKKLIKGESDCAISKKQIQTFTK
KNRMKKINDSSPKNQIKLKRKQLVKDGCFGKKKKKKKESVEDNKSMESIEENAKESISRS
GRVRKVKNVTKDLIPCKNKLGKKSRVVTENCNETKEENKAENSGKLTPSSTVSLPDPGDE
CKKVESGKENLKTRVDSALLQNALNESVECWFDITSVVEKKGKRLRRKTKMMPKLNESEN
SKNIDDDDDDDDDDNVPSTEKKIKTEISVGEENGNDDEGDSVEEKNTRNKKIKDVDSCRN
EISNKVIEKTNNEKPETETKDSNSSVNSEDTMKKINDEEIVMNCEESKSTKKNTNDDEEA
EEAEENSTDVNKTIESLTTNNKKVKNVNRQLIGYRKKRRKVRNVLLSKRVKNYGEKINFG
LDLNPEEGIKGKKKMESPDVECNDDTENNRDDVVKDGNANDLEKNLKFSDVECNKKEEEK
KINESYPCLTEKEDDLVTRKRKKRSLSADANKIPSSSKTKENFNRPSSLPPEEVGGKIKD
GDVSNENETKKENLIKGKSEKTKEVLPRKKKQMLGSKRVLRNNSANRNKSEPEKKVADGE
DKPEKNVEPRLQLEEEKIVSHIDDAESNSIPDDDTKSEEGDEKIEIPEENLTQSSEEKVN
DEDEEMDEEVTSIDNDEKKKAEESEESLTETSEKNLTPLVESDKNEKPTSVSEGEEEEEE
ENSNEKPESEETMPEENESDGCLNVGNSETDKQNDEGLDDDYKTSEDARETTSETGNEKK
EKKKRKNVVELLGQNVIVNPEDQNNDRRKSFREIKMTPKLVDMIATSSSHKRIKRTTSIK
DDGGVLTSKEKNTETETEFEYSNLIRKVTRCEEDQDEIDENDEPEQSGEGMENYLQSKME
ENASNFECNWEPGDLVWARFAGNPFWPGLILRDPFNNDEYSKVKYLGRLPRPFVHVQFLA
DWGRRAWGPELYIMSFTGMDNFEKMKWDLPEVNTFTQRKDLLYQQAFFIPKRMEKHWMRA
VKEGEALLCKTKDERITYMKIKYPLVKYAESVANGRLVPNERVIKSGDSKSPQGGKINKK
RRMTGPAWSAGEESSDWTGDNSEKAATAEEAIDKATGFECVNTSSDLDEGTKNSDKDSPK
ITLKFVRSPKKNSKRKFRKSVETDGKVKKRIRKDGNEEEYVCQICFEFLENEKTIKCKGL
CQGSFHKSCTEKLNANLPPIDETHMPVIKNKRRRKLFANGDSDSPCEAQEKDEEQDWMCG
DCLRGENPCFVCNSRSGNRQRCCAAYCGKFYHQKCLKLFPQTIYNQGAPIRKSHALQQNK
TSNSESPHYQILSCPLHVCHTCASDNPSDCNSKYLSERLVKCIKCPSAYHVGNYCVPAGS
TILNTSQIICVKHGDTNKKSHVNISWCFICNMGGSLICCDWCPSSFHLDCLNIKPPEGPY
ICEECESGRFPLYGEVVWVKMGRYRWWPARVLFPQEIQGNIMALPHKSWEFVVRFYGSND
HYWLNRGRVFLFQEGDSEQKFKGQSHVDKIYQRAVQEATKDYFALQEERKSRLMESNNSN
VPRPPPFVKIKTNRPVGKVQLGSGYQSEPQTCDCDPNYESPCGPGSDCLNRMLLVECNPN
YCNAGTRCKNQSFEKREYPPLEPYRTERRGWGLRSTVDIPKGSFVIEYVGEVVDDEEFKR
RMKRKQETMDNNYYFLTIDKDRIIDAGPKGNLARFMNHSCSPNCETQKWTVNMDTRVGLF
ALEDIPAGTELTFNYNLDCVGNEKKACHCEEENCSGFIGVKVKNDKTEKKLVKRLEKESE
DECFVCQDGGELMVCDVPNCPKVYHIECVGLEEWPNEMWFCPRHRCSLCKKQTKRCCKLC
TTAFCFAHLDNNMFPDNKGGLLCSAHSTTAVKPIQPLRKASYINRNTPVIEYEKPFVEKY
KPPPPPQLSQKEKTGSGENDESILMEPNLTDSTPIVVENQLLSTSSPPPDSSNKLNEDGV
SVQVFYVNDEGQVVGFDGTSDGKSVEVLPQILVEGQTVKNVRKKKRTNIPRKKLNPPLIK
SPAGGPENNNEQEKQKRVQGGINFESLMIKSVEDKILDSKLNMDNIYNIIGGGGGGGSTD
AGRGGVATGSQGDKNQMEKCSRVRVVNESGDVKESSSLIKKEEAAEMDRSRRSKYFKIIT
PEKFIKVNSESETNQKTVTDFNYIEFMHPLRSASKSKSTTTKADENLRK
NT seq 6810 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgttcatataactcatatcgatggggaaccgccaatatatagagaaatgaaa
gcggtttctgtgtcattggatcaatgcatattaaacagcgaagaagattatcagtataat
gagggtgaggaaagtttaatgtgcaaagattatgtcgatggtgatttatcagcggaagaa
atcaattcgatgataatgataaacgaaggaccgaatgcattagagtatttaagtactaaa
tcattacaaaaattaagtgggcccaataaaaaattgggaaaaaataaagtaaggaagaaa
ttgattaagggtgagagtgattgtgccattagtaaaaaacaaattcaaacgtttacgaaa
aaaaatcgtatgaaaaaaataaatgattcgagtcctaaaaatcaaattaaattaaaaaga
aaacaattagttaaagatggttgttttggtaagaaaaagaagaaaaaaaaagaaagtgtt
gaagataacaaatcgatggaatccatcgaggaaaatgcaaaggaaagcatttcaagatca
ggtagggttagaaaagtgaaaaacgttacgaaggatttgataccgtgtaaaaataaattg
ggaaaaaaatcacgtgtcgttactgaaaattgcaacgagacgaaagaggaaaacaaagcg
gaaaattcaggaaaactcacaccctcttctacggtttctctacccgatccgggggatgaa
tgtaaaaaggttgaaagcggtaaagaaaatttaaaaactcgagtcgattctgcactttta
caaaacgcattaaacgaatccgtggaatgttggttcgatataacttccgtcgtagagaaa
aagggtaaaaggttaaggagaaaaacgaaaatgatgcctaaattaaatgaatcggaaaat
tctaaaaatattgatgatgatgatgatgatgatgatgacgacaacgtaccgagtacggaa
aaaaaaataaagactgaaattagcgtcggggaggaaaatggaaacgacgacgaaggggat
tccgtcgaagagaaaaatacgagaaataaaaaaataaaggatgttgatagttgtcgaaat
gaaatttcgaataaagtcatagagaaaacaaacaatgaaaaaccggaaacggaaacgaaa
gattcaaattcttcagtaaatagtgaagatacgatgaagaaaatcaatgatgaggaaatt
gttatgaattgcgaggaatctaaaagtacaaaaaaaaatacgaacgatgatgaagaagca
gaagaagcagaagaaaattctacggatgtaaacaaaacgatagaatcattaacgacaaat
aataaaaaagttaaaaatgttaatcgtcaattaatcggttataggaaaaaaaggcgaaaa
gttcgaaacgttttactaagcaaacgtgtaaaaaattacggtgaaaaaattaatttcgga
ttagatttaaatccggaagaagggattaagggaaaaaagaaaatggagtcaccggatgtt
gaatgtaatgacgacacggaaaacaatcgggacgacgtcgtcaaagatggaaatgcaaac
gatttggaaaaaaatttaaaattttccgacgttgaatgtaataaaaaagaagaagaaaaa
aaaataaatgaaagttacccgtgtttaactgagaaggaggatgatttggtaacgagaaaa
cgaaagaaaagatctcttagcgctgatgcgaataaaatcccttcctcgagtaaaacgaaa
gaaaatttcaacagaccctcatcgttacccccggaagaagtcgggggaaaaatcaaagat
ggcgacgtatcaaatgaaaatgaaactaaaaaagagaatttaattaaagggaaaagtgaa
aaaaccaaagaagttttacctcgcaaaaagaagcaaatgttgggatcgaaaagagttctt
agaaacaattcggcgaatcgaaataagtctgaacctgaaaaaaaagtcgcggacggtgaa
gataaacctgaaaaaaacgtcgaacctcgtttacaactagaagaagaaaaaattgtttct
catatcgatgatgcagaatcgaattcgatacctgacgacgataccaagtcggaggagggt
gatgagaaaatcgaaatacctgaagaaaatttaacacagagttctgaagaaaaagtaaac
gatgaagatgaagaaatggacgaagaagttacttcgattgataacgatgagaagaaaaaa
gcagaagaaagtgaagagtctcttaccgaaacgtcagaaaaaaatttaacgccgttagta
gaatctgataaaaatgaaaagccaacttccgtttccgagggtgaagaagaagaagaagaa
gaaaattccaatgaaaaacctgaatctgaagaaactatgccggaagaaaacgaaagtgat
ggttgtttaaatgttggcaacagtgaaactgataaacaaaacgacgaaggtttagatgat
gattacaaaacgtcagaggacgcacgggaaacaacttcggagaccggaaatgagaaaaaa
gaaaagaaaaaaaggaaaaatgtcgtcgaattattagggcaaaatgttattgttaatccc
gaggatcagaataacgacagaaggaaaagttttagagaaataaaaatgactccgaaatta
gtcgatatgatagcaacgagttcgagtcataagaggataaaaagaacgacgtcgatcaaa
gatgatggcggagttttaacaagcaaagaaaaaaatacggaaacggaaacggaatttgaa
tattcgaatttgattcgtaaagtcacgaggtgcgaggaggatcaagatgaaatcgatgaa
aatgacgaacctgaacaatcgggagaagggatggaaaattacttgcaatccaaaatggaa
gaaaatgcatccaatttcgaatgcaattgggaaccgggagatttggtttgggccagattt
gcggggaatccattttggccgggtttgatattgagagacccgttcaacaacgacgaatat
tccaaagttaaatatttgggccgattaccgcgtccgttcgtacacgttcaatttttagca
gattggggtagacgtgcgtggggacccgaattgtacataatgagcttcaccggaatggat
aattttgaaaaaatgaaatgggatctaccggaagtgaacacgttcacgcaaagaaaagat
ttactctatcaacaagctttcttcattcccaaaagaatggaaaaacattggatgagagcc
gtgaaagaaggggaagccctgttatgcaaaaccaaagatgaaagaataacgtacatgaaa
ataaaatatccgttggtaaaatatgcggaatccgttgcgaacggtcgattagttcctaac
gaacgcgtcatcaaatcgggagattcgaaatctccgcagggaggtaaaataaataaaaag
agaagaatgaccgggcctgcatggtctgccggtgaagaatcatcagattggacgggggac
aacagcgaaaaagctgccacggctgaggaagccatagataaagccaccggttttgaatgt
gtcaatacttcttcggatttggatgagggaacgaaaaacagcgataaggactccccgaaa
ataacattgaaattcgttaggagtcctaaaaaaaattctaaaagaaaatttagaaaatcg
gttgaaacggatggaaaagtcaagaagagaattcgaaaagatggtaacgaagaagaatat
gtttgtcaaatttgttttgaatttctcgaaaatgaaaaaacaatcaaatgcaagggtttg
tgccagggttcgtttcacaaatcttgcacggaaaaattgaatgctaatttaccgcccatc
gacgaaactcacatgcccgtcattaaaaataaaaggagaagaaaattgttcgcgaacgga
gattccgattctccgtgcgaagcccaagaaaaagacgaagagcaagattggatgtgcggg
gattgtttgcgtggggaaaatccttgtttcgtttgtaatagcaggagcggaaataggcaa
aggtgttgcgccgcttactgcggaaaattttatcatcaaaaatgtttgaaattatttccg
caaacgatttacaatcagggagctcccataaggaaatcgcacgctttgcaacaaaataaa
acgtccaattcggaatcgccgcactatcaaatccttagttgtccactacacgtgtgtcac
acgtgcgcttcggacaatccttccgattgtaattctaaatatttgtctgaaagacttgtt
aaatgcataaaatgtccaagcgcgtatcacgtgggtaattattgcgttccagccggaagc
acgatactgaacacgtcgcaaattatttgcgttaaacacggggatacgaataaaaaatct
cacgtaaacatatcttggtgttttatatgtaacatgggtggatctttaatatgttgcgat
tggtgtccctcatcctttcacttagactgtctcaatattaaacctcccgagggaccctac
atatgcgaagaatgcgaatccggaagatttcccttgtacggagaagttgtttgggtcaaa
atgggtcgatatagatggtggcctgcaagagttttatttccgcaagaaatacaaggaaac
ataatggctcttccgcacaaatcctgggaatttgtcgttagattttacggttcaaacgat
cactattggttgaacagaggacgagtatttttatttcaggaaggagattccgaacaaaag
ttcaagggtcaatctcacgtcgacaaaatttaccaaagagcagtacaagaagcgacgaaa
gattatttcgctttgcaagaagaaagaaaatcgagactcatggaaagcaataattcaaac
gttccgcgacctcctccattcgtgaaaataaaaacaaacagacccgttggaaaagttcaa
ctgggatccggttatcaatcggaacctcaaacctgtgactgtgatcctaattacgaatct
ccctgcggtccgggttcggattgtttaaatcgcatgctcctcgtcgaatgcaatccgaat
tattgcaacgcgggaacccggtgtaaaaatcaaagttttgaaaaaagggaatatccgcca
ttagaaccttacagaactgaaagaagaggttggggattgagatcgactgtcgatattcct
aagggatcatttgttatcgaatacgtcggagaagtcgtagatgatgaagaatttaaaagg
agaatgaaaagaaaacaggaaactatggacaataattattattttctaacgatagacaaa
gatagaataatcgatgcggggccaaagggaaatttagcgaggttcatgaatcattcgtgc
tcgccgaattgcgaaacgcaaaagtggacggttaacatggacacaagagttggacttttc
gcactcgaagatattccagcgggaaccgaattgacttttaattataatttggattgcgtt
ggaaacgaaaagaaagcgtgtcactgcgaagaagaaaattgttccggttttataggagtt
aaagtcaagaacgacaaaacggagaaaaaacttgtaaaaagattggaaaaagaaagcgaa
gacgaatgtttcgtttgtcaagatggcggagaattgatggtttgcgacgtgcccaattgt
ccaaaagtttatcatattgaatgcgtgggattagaagaatggcccaacgaaatgtggttt
tgtcctcgtcatcgttgttcgttatgtaagaaacaaactaaaagatgttgtaaattgtgt
acgaccgcgttttgctttgctcatttagacaacaacatgtttcccgataacaagggtgga
ttgttgtgcagtgcccacagcacgacagccgtcaaacccattcaacctcttcggaaagct
tcgtacataaatagaaacacgccggttatagagtacgagaaacctttcgtagaaaaatac
aagccgccgcctccgcctcaactttctcaaaaagaaaaaacggggagcggggaaaacgat
gagtcgatattaatggaacccaatttaaccgacagcacgcccatagtggttgaaaatcaa
ttgttgtcaacttcttcgccaccccccgattcctcgaacaaattaaacgaggacggcgtt
agcgttcaggttttttacgtcaacgacgaaggtcaggttgtaggtttcgacggaacgagc
gatggtaaatcagttgaagttttgccgcagatattggtcgaaggtcaaacggtaaaaaac
gtacgtaaaaaaaagagaacgaacatacctaggaaaaaattaaatccgccattgataaaa
agtcccgcgggaggcccggaaaacaacaacgagcaagaaaaacaaaaacgagttcagggc
ggcatcaatttcgaatccctcatgatcaaaagcgtcgaagataaaattctcgattcgaaa
ctcaacatggacaacatatacaacataatcggtggtggtggcggtggtggtagcaccgac
gccggaagaggaggagtagcaacaggaagtcagggtgataaaaatcaaatggaaaagtgc
agcagagtaagagttgtaaacgaaagcggtgacgttaaagaaagtagtagcctgataaaa
aaagaggaagctgcggaaatggaccgatcgagacgatcgaaatattttaaaataataacg
ccggaaaaattcattaaagtgaattcggaaagtgaaacgaatcaaaaaaccgttacggat
tttaattacattgaattcatgcatccgctcagatcggcgtccaaaagcaaaagcacgacg
acaaaagcagacgaaaatttaagaaagtaa

DBGET integrated database retrieval system