KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM441290Help
Entry
Phum_PHUM441290   CDS       T01223                                 

Definition
insulin receptor substrate-1, putative
Orthology
K16172  
insulin receptor substrate 1
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Phum_PHUM441290
   04150 mTOR signaling pathway
    Phum_PHUM441290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 288 aa AA seqDB search
MKKKFFILRGESSDASARLEYYDSEKKWRNSQPPKRTISLKTCFNINRRKDTKHKYVIAL
YTKDDCFCIVLDSEEDLQEWLRVLLKLQTGEECVDGEQPKPNFEHVWKVTLQEKGLGDSK
NLVGPYHVCLTDQTLTLVKITEDDAKPETLEFPLIYIRSCGVTGSFFYIEVGRQTVTGAG
ALWMLTEDANIAKNMNEVIFSAFSVQQKNQKDSNPHRKRSSSATESSKPTSILQRRQTHG
PTKPIVSSGYSDKRTNKQTNKQTNYTFCYLFILFSYDDLPIYDSKRID
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaattttttatactgagaggagaatcgtcggatgcgtctgccaggttggaa
tattacgacagcgaaaaaaaatggagaaattctcaaccgcctaaaagaaccatatcattg
aaaacgtgtttcaacataaacaggaggaaggacacgaaacacaaatacgtcatcgccctg
tacacgaaagatgattgtttctgcattgttttggattcggaagaagatcttcaggagtgg
ttgagagttttattgaaattacaaacgggagaagaatgcgtggacggagaacagcccaaa
ccaaatttcgagcacgtgtggaaggtgacgctgcaagaaaagggattaggagattcgaaa
aacttggtcggtccttaccacgtttgcctaacggatcaaactctgacgttggttaaaata
acggaagacgacgcgaaaccggaaacgttggaattcccattgatatacatacggagttgc
ggtgtgacgggaagttttttttacattgaagtcggtcgtcaaaccgtgaccggagcggga
gccctttggatgctcacggaagatgccaacatagccaagaacatgaacgaagtcatattc
agcgcttttagcgttcagcaaaaaaatcaaaaggattcgaatccgcacaggaagaggtcg
tcgtctgcgacggagtcttcaaagcccacgtcgatactgcagaggcgtcaaactcacggt
ccgaccaaacccattgtgtccagcggttattcggacaaacgaacaaacaaacaaacaaac
aaacaaacaaattacacgttttgttatttatttattttattttcgtacgacgatttgccc
atttacgattcgaaaagaatcgattaa

DBGET integrated database retrieval system