KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM450440Help
Entry
Phum_PHUM450440   CDS       T01223                                 

Definition
Single-strand selective monofunctional uracil DNA glycosylase, putative
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Phum_PHUM450440
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Phum_PHUM450440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 266 aa AA seqDB search
MSSLECDVSNTFSKNYKFSERLFDIENDMSNELELLNFKPPIEYVYNPLKYAKNLHENFT
KKYFEKCTKKILFLGMNPGPWGMCQTGVVFGEKNFIKDWMKLSGKVSKPHIEHPKKKISG
LECNRTEISGKKFWGFFKKLCKTPEQFFKHSFVYNHCCLAFMDATGKNITPPEIKDLAIK
KKLYEICDRALIKILKEFHFEIIVAIGKFAEKNALTALKKNGIGNVKVLSIPHPSPRNAK
NFSNWEEVTLNKLENNKLLKFFKDNQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttagagtgtgacgtttcaaacacattttcaaagaattataaatttagtgaa
agattattcgatatagaaaatgatatgtctaatgaattggaattattaaattttaaacca
cctattgaatatgtttacaatccactaaaatatgctaaaaatttacacgaaaactttact
aaaaaatattttgaaaaatgtactaaaaaaatattatttctcggaatgaatcctggtccc
tggggaatgtgtcaaacaggtgtagtgtttggtgaaaaaaatttcattaaagattggatg
aaattatcaggtaaagttagtaaaccacatattgaacatccgaaaaaaaaaattagtgga
cttgaatgcaatcgtactgaaataagtggtaaaaaattttggggattttttaaaaaatta
tgtaaaactcctgaacaattttttaaacattcttttgtatataatcattgttgcttagcc
tttatggatgcaacagggaaaaatattacacctccagagattaaggatttagcgattaaa
aaaaaattgtatgaaatttgcgatcgagccctaattaaaattcttaaagaatttcatttt
gaaataattgtagctattggaaaatttgctgaaaaaaatgctttaactgcccttaaaaaa
aatggaattggaaatgtaaaagtattgtcaatacctcatccgagccctcgtaatgccaaa
aatttttcaaattgggaagaagtgacattaaacaaattagaaaataacaaattactcaaa
ttctttaaggataatcagtga

DBGET integrated database retrieval system