KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM451270Help
Entry
Phum_PHUM451270   CDS       T01223                                 

Definition
histone-lysine N-methyltransferase SUVR5, putative (EC:2.1.1.43)
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Phum_PHUM451270
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Phum_PHUM451270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 286 aa AA seqDB search
MEIIDDETQFIDDDYDHSNPGLFYTVTRIGKEFEYYEKGCNCENSNCTTETGCDCLKYGD
NYQLNDEGNLILKNDKFDNALPIFECNFNCSCFRHVFENRNRHGSGKVSKLFCPNRNVQF
GPLKTLEIFDAGKKGLGLKTNETIRRGTFICEYAGEIINLKTAKEREKNQRDDMNYIFIC
KEYAGDKFCNVTIVDPTFIGNVGRYINHSCQPNSVIVPIRVNDSTPHLCVFAIRDIEKNE
EICYDYSGRNRIETTPSNEIDFPNRKLCYCQSPSCKSFLPYELNRD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaaattatagacgacgaaacgcaattcatcgacgacgattacgatcactcgaatccc
ggattgttttacacagtgacgagaatcggaaaggaattcgaatactacgaaaaaggttgc
aattgtgaaaattctaattgcacgacggaaacgggttgcgattgtttgaaatacggcgac
aattatcaattgaacgacgagggaaatttgatattgaaaaatgataaatttgacaacgca
ttacccattttcgaatgtaatttcaattgttcttgttttcgacacgtgtttgaaaatcga
aatcgtcacggaagtggaaaagtttcgaaacttttttgcccgaatcgtaacgttcaattc
ggaccgttgaaaactctcgaaatattcgacgcgggaaaaaaaggtttgggtttgaaaacg
aacgagacgatacgtcggggtacgttcatttgcgaatacgcgggagaaattataaatttg
aaaacggcaaaagagcgggaaaaaaatcaacgcgatgacatgaattacatattcatatgt
aaagaatacgcgggtgataaattttgcaacgtcacgatcgtcgatccgacttttatcgga
aacgtcggacgttacataaatcacagttgccaacctaattccgtcattgttccgattcga
gtgaacgattcgactcctcacttgtgcgtgttcgcaattcgagatatcgaaaaaaacgaa
gaaatttgttacgattattccggtcgaaatcgtatcgaaactactccatcgaacgaaatc
gattttcctaatagaaaactttgctattgtcaatcaccctcgtgtaaatcctttttaccc
tatgaacttaacagagactga

DBGET integrated database retrieval system