KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM456250Help
Entry
Phum_PHUM456250   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Phum_PHUM456250
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     Phum_PHUM456250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 930 aa AA seqDB search
MAETKSSNDNLSARSNNFICGVVEGFYGRPWTTEQRKDLFQKLKKWGMNSYLYAPKDDYK
HRAYWRELYTVEEAEHLTSLILSAKEQGIAFYYAISPGLDITYSSAKEVTYLKRKLEQVS
QFGCTAFALLFDDIEPEMSEADKEVFQSFAHAQVSVTNEMYQHLGQPVFLLCPTQYCAAR
ASPNVGNSEYLNTLGAKLPQEIDIMWTGPKVISRTLTIESIEEITEVLRRPPVIWDNLHA
NDYDQKRVFLGPYSGRSPDLIPKLRGVLTNPNCEYGANFVAIHTLAQWSRCNIDAIRDPS
LNDTVSADIKLETEGVNEEGPCGLSPNMYHPRRALKNAINEWLPEFKKFKPAWGPIAKPQ
QVIAAPVPIPIIPSVNTCMSLTSTTMTTNSVAVPVCSANQLQALAEVCSTVQSNESLVQP
TSVSVMNSLASETKVLPLTTNKNCKNTNQEPMDCNPTSGISPDSPVQGSSLVSDVAMAET
VVTESNGSTMQIESTSDENICNSNIQMVVDGSSSTSLNEENVENNELGNEKKLTLADLTL
LCDLFYLPFEHGGSGIQLLQEFHWLKINAHVLASSGKQPGDKEVTRSSKSEVEEWFDRAK
QFQELTKSVNTLFQRLTFCANRELLYDLYPYIWDIRGVVSLLNSYVKWLAGGRFPGLVST
YTLGQYTWFSKGWKEAFMSGEQEPWVFRGGLTADLQRLLPVDSGTDLFMYKAPEVPSCKI
YTVRPYMSSDKPQVYDVCAKVSCSSDIPVQLKKLPGDRIVGSYLEYASEFCLVVEDETEI
VGFATAALDSKQFFKNLSNSYIEKMKKKYPLDDDDDDDNGDVDGNVKVKEFIEYFHTTDY
HSPELIHNQYPSVMACEILPSVTDQSVSKRLLACLLAALRANGSFGVYVSIDFNNRSAFE
FYSKLGFIEITPQSVGADKTNKITYLGRSF
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaccaaatcgtccaatgataatttaagtgcaagaagcaataattttatatgt
ggagttgtagaaggattctacggcagaccgtggacaacggaacagagaaaagatttattt
cagaaattaaaaaaatggggaatgaattcttatttatacgcccccaaagatgattataaa
catagagcttattggagagaactttatacagtagaagaagcagaacatttaacaagttta
attttatccgctaaagaacaaggcattgcattttactatgctatttctccaggacttgat
attacttattctagtgccaaggaagtaacttacttaaaaaggaaattggaacaagtatct
caatttggttgcactgcctttgcccttctatttgatgatattgaacctgaaatgtcggaa
gcagacaaagaagtatttcaatcgtttgcacatgcccaggtttctgttacaaatgaaatg
tatcaacacctggggcaacctgttttccttttatgtcccacacaatattgtgctgccaga
gcctcaccgaatgttggaaattcagaatatttaaatacacttggagcaaaactcccacaa
gaaattgatattatgtggactggtcctaaagtaatatctagaacactaactattgaatct
atagaagaaataactgaagttttaaggagacctccagttatttgggataatctacatgct
aacgattatgatcaaaaaagagtatttttaggtccttattctggtagatcgcctgattta
ataccaaaacttagaggagttttaacaaatcccaattgtgaatacggagccaattttgta
gccatccacacattagcacaatggagtaggtgcaatatagatgccattagagatccttct
ttaaatgataccgtttctgctgatattaaattagagactgaaggagttaatgaagaaggc
ccttgtggtctttctccaaatatgtatcatcctaggagagctcttaaaaatgcaattaac
gaatggttacctgaatttaaaaaatttaaacctgcatggggtccaatagcgaaaccacaa
caagtgatagctgcaccagttcctattccaatcattccatccgtaaacacttgtatgtct
ctgacttcaacaaccatgactacaaattctgtggcagtacctgtttgtagtgcgaatcaa
ctccaagctctagcagaagtttgtagcacagttcaatcgaacgaatcattagttcaaccc
acctcggtatcagtaatgaattcattagcatccgaaaccaaagtcttacctttaactact
aataaaaattgtaaaaatacaaatcaagagccaatggattgcaatcccacatctggaatc
agtcccgatagtccggttcagggtagttcactggtctctgatgtagcaatggccgaaact
gttgtaaccgaatcgaatggttctacaatgcaaatagaaagcacttcggatgaaaatatt
tgtaattctaatattcaaatggtggtagatggtagtagtagcacgtcattaaatgaagaa
aatgtagaaaataacgaattaggaaatgaaaaaaaattaacattggcggatttgacattg
ctttgcgatttgttttatcttcccttcgaacatggcggatcgggaattcaacttttgcaa
gaattccattggttgaaaataaatgctcacgttttagcaagttctggaaaacaacccgga
gacaaagaagtaacaagaagttctaaatcagaggttgaagaatggtttgacagagcgaaa
caatttcaggaattaactaaaagcgtcaacacattatttcaacgtcttactttttgcgca
aatagagaacttctatacgatctttatccttatatatgggatattagaggagtcgtgtca
cttttaaattcatatgttaaatggcttgctggtggacgatttcccggtttggtgtcgaca
tacactctaggacagtacacatggttttcaaaaggttggaaagaagctttcatgtcgggt
gaacaagaaccatgggttttccgcggtggactcacagcggatcttcagagattgttaccc
gttgattcgggtacggatttgtttatgtataaagcaccggaagttcctagttgtaaaata
tacactgtgagaccttacatgtcttccgataagccgcaggtatatgacgtatgcgccaaa
gttagctgtagttctgatatacccgtccaattgaaaaaattacccggagatagaatcgta
ggaagttatttagaatacgcgtcggaattttgtttagttgtcgaagatgagactgaaatt
gtcggttttgcaacggccgcattagattcaaaacaattttttaaaaatttatcaaattcg
tatattgaaaaaatgaaaaaaaaatatccactcgatgatgatgatgatgatgataatggc
gatgttgatggaaacgttaaagtgaaggaattcattgaatattttcacacgacggattat
cattcgccggaattaatacataatcaatatccgtctgtgatggcgtgtgaaattttacca
tcggtaacggatcaaagcgtgtctaaaagacttttagcttgtttgttggcagcacttcga
gcaaacggatctttcggagtttacgtatcgatagattttaacaatcgtagcgctttcgaa
ttttactctaaattgggttttattgaaatcacaccacaaagcgttggagcggataaaacg
aataaaataacttatttgggaagatcgttttaa

DBGET integrated database retrieval system